- DEPOD Home
- About DEPOD
- User Manual
- Human Phosphatases
- Protein Substrates
- Non-Protein Substrates
- Pathway Mapping
- Dephosphorylation Network
- ID Mapping
- Download
- Acknowledgement
- Contact
- Imprint
- Links
- Ensembl
- Entrez Gene
- HGNC
- QuickGO
- Gene Expression Atlas
- OMIM
- UniProt
- IntEnz
- BRENDA
- LocDB
- M-CSA
- InterPro
- Pfam
- CATH
- Gene3D
- PDB
- PDBe
- DrugPort
- ModBase
- SwissModel
- ChEMBL
- Phospho.ELM
- PhosphoSitePlus
- NetworKIN
- HPRD
- PSICQUIC
- STRING
- IntAct
- MINT
- KEGG Pathway
- Reactome Pathway
- Pathway Commons
- PubMed
- Europe PMC
- ArchSchema
- Cytoscape Web
- EKPD
- SwissLipids
Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
Top
SMAD1
Gene Name  | SMAD1 (QuickGO) | (A quick tutorial to explore the interactive visualization) Representative structure: 1KHU |
| Synonyms | SMAD1, BSP1, MADH1, MADR1 | |
| Protein Name | SMAD1 | |
| Alternative Name(s) | Mothers against decapentaplegic homolog 1;MAD homolog 1;Mothers against DPP homolog 1;JV4-1;Mad-related protein 1;SMAD family member 1;SMAD 1;Smad1;hSMAD1;Transforming growth factor-beta-signaling protein 1;BSP-1; | |
| Protein Family | Belongs to the dwarfin/SMAD family | |
| EntrezGene ID | 4086 (Comparative Toxicogenomics) | |
| UniProt AC (Human) | Q15797 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 52260 Dalton | |
| Protein Length | 465 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000170365 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG3701 | eggNOG - ENOG410XQKU | |
| Phosphorylation Network | Visualize | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | |||
| Gene Expression | Gene Expression Atlas | Disease | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus |
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm Nucleus Note=Cytoplasmic in the absence ofligand Migrates to the nucleus when complexed with SMAD4(PubMed:15647271) Co-localizes with LEMD3 at the nucleus innermembrane (PubMed:15647271) Exported from the nucleus to thecytoplasm when dephosphorylated (By similarity) | |||
| Function (UniProt annotation) | |||
| Transcriptional modulator activated by BMP (bonemorphogenetic proteins) type 1 receptor kinase SMAD1 is areceptor-regulated SMAD (R-SMAD) SMAD1/OAZ1/PSMB4 complexmediates the degradation of the CREBBP/EP300 repressor SNIP1 Mayact synergistically with SMAD4 and YY1 in bone morphogeneticprotein (BMP)-mediated cardiac-specific gene expression | |||
| Catalytic Activity (UniProt annotation) | |||
| N/A | |||
| Protein Sequence | |||
| MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHR KGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLG QNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQ PMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRN STIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGF ETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS | |||
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
| ELM Motif | Motif Instance | Description | Motif Regex |
| LIG_WW_1 | 224-PPAY-227 | WW domain ligands | PP.Y | MOD_GSK3_1 | 199-SSSTYPHS-206 | GSK3 phosphorylation site | ...([ST])...[ST] | MOD_GSK3_1 | 207-PTSSDPGS-214 | GSK3 phosphorylation site | ...([ST])...[ST] |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0000978 | F:RNA polymerase II proximal promoter sequence-specific DNA binding |
| GO:0000981 | F:RNA polymerase II transcription factor activity |
| GO:0001077 | sequence-specific DNA binding |
| GO:0003700 | F:transcriptional activator activity |
| GO:0005622 | RNA polymerase II proximal promoter sequence-specific DNA binding |
| GO:0005634 | F:DNA-binding transcription factor activity |
| GO:0005637 | C:intracellular |
| GO:0005654 | C:nucleus |
| GO:0005667 | C:nuclear inner membrane |
| GO:0005737 | C:nucleoplasm |
| GO:0005829 | C:transcription factor complex |
| GO:0007165 | C:cytoplasm |
| GO:0007179 | C:cytosol |
| GO:0007183 | P:signal transduction |
| GO:0009880 | P:transforming growth factor beta receptor signaling pathway |
| GO:0010628 | P:SMAD protein complex assembly |
| GO:0016021 | P:embryonic pattern specification |
| GO:0016579 | P:positive regulation of gene expression |
| GO:0017151 | C:integral component of membrane |
| GO:0019901 | P:protein deubiquitination |
| GO:0030509 | F:DEAD/H-box RNA helicase binding |
| GO:0030618 | F:protein kinase binding |
| GO:0031053 | P:BMP signaling pathway |
| GO:0032991 | F:transforming growth factor beta receptor |
| GO:0042802 | pathway-specific cytoplasmic mediator activity |
| GO:0045944 | P:primary miRNA processing |
| GO:0046872 | C:protein-containing complex |
| GO:0060395 | F:identical protein binding |
| GO:0070410 | P:positive regulation of transcription by RNA polymerase II |
| GO:0070411 | F:metal ion binding |
| GO:0070878 | P:SMAD protein signal transduction |
| GO:0071141 | F:co-SMAD binding |
| GO:1901522 | F:I-SMAD binding |
| GO:1903672 | F:primary miRNA binding |
SMAD1 is dephosphorylated by following phosphatases:
| Phosphatase Gene Name | Phosphatase UniProt_AC | DephosphoSite and sequence (+/-5) in SMAD1 (Q15797) | Bioassay Type | PubMed ID | View in Europe PMC | Reliability of the interaction |
| PPP2CA | P67775 | NA | In vitro and in vivo | 19339557, | Europe PMC |  |
| PPP2CB | P62714 | NA | In vitro and in vivo | 19339557, | Europe PMC | |
| PPM1A | P35813 | NA | In vitro and in vivo | 16931515, | Europe PMC | |
| CTDSP1 | Q9GZU7 | Ser-187_HPFPHsPNSSY,, Ser-195_SSYPNsPGSSS,, Ser-206 _STYPHsPTSSD, | In vitro and in vivo | 17085434, 16882717, | Europe PMC | |
| CTDSP2 | O14595 | Ser-187_HPFPHsPNSSY,, Ser-195_SSYPNsPGSSS,, Ser-206 _STYPHsPTSSD, | In vitro and in vivo | 17085434, 16882717, | Europe PMC | |
| CTDSPL | O15194 | Ser-187_HPFPHsPNSSY,, Ser-195_SSYPNsPGSSS,, Ser-206 _STYPHsPTSSD, | In vitro and in vivo | 17085434, 16882717, | Europe PMC | |
| PDP1 | Q9P0J1 | NA | In vivo | 16510868, | Europe PMC | |
| PDP2 | Q9P2J9 | NA | In vivo | 16510868, | Europe PMC | |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| hsa04350 | TGF-beta signaling pathway | The transforming growth factor-beta (TGF-beta) family members, which include TGF-betas, activins and bone morphogenetic proteins (BMPs), are structurally related secreted cytokines found in species ranging from worms and insects to mammals. A wide spectrum of cellular functions such as proliferation, apoptosis, differentiation and migration are regulated by TGF-beta family members. TGF-beta family member binds to the Type II receptor and recruits Type I, whereby Type II receptor phosphorylates and activates Type I. The Type I receptor, in turn, phosphorylates receptor-activated Smads ( R-Smads: Smad1, Smad2, Smad3, Smad5, and Smad8). Once phosphorylated, R-Smads associate with the co-mediator Smad, Smad4, and the heteromeric complex then translocates into the nucleus. In the nucleus, Smad complexes activate specific genes through cooperative interactions with other DNA-binding and coactivator (or co-repressor) proteins. |
| hsa04390 | Hippo signaling pathway | Hippo signaling is an evolutionarily conserved signaling pathway that controls organ size from flies to humans. In humans and mice, the pathway consists of the MST1 and MST2 kinases, their cofactor Salvador and LATS1 and LATS2. In response to high cell densities, activated LATS1/2 phosphorylates the transcriptional coactivators YAP and TAZ, promoting its cytoplasmic localization, leading to cell apoptosis and restricting organ size overgrowth. When the Hippo pathway is inactivated at low cell density, YAP/TAZ translocates into the nucleus to bind to the transcription enhancer factor (TEAD/TEF) family of transcriptional factors to promote cell growth and proliferation. YAP/TAZ also interacts with other transcriptional factors or signaling molecules, by which Hippo pathway-mediated processes are interconnected with those of other key signaling cascades, such as those mediated by TGF-beta and Wnt growth factors. |
| hsa04550 | Signaling pathways regulating pluripotency of stem cells | Pluripotent stem cells (PSCs) are basic cells with an indefinite self-renewal capacity and the potential to generate all the cell types of the three germinal layers. The types of PSCs known to date include embryonic stem (ES) and induced pluripotent stem (iPS) cells. ES cells are derived from the inner cell mass (ICM) of blastocyst-stage embryos. iPS cells are generated by reprogramming somatic cells back to pluripotent state with defined reprogramming factors, Oct4, Sox2, Klf4 and c-Myc (also known as Yamanaka factors). PSCs including ES cells and iPS cells are categorized into two groups by their morphology, gene expression profile and external signal dependence. Conventional mouse-type ES/iPS cells are called 'naive state' cells. They are mainly maintained under the control of LIF and BMP signaling. On the other hand, human-type ES/iPS cells, which are in need of Activin and FGF signaling, are termed 'primed state'. However, these signaling pathways converge towards the activation of a core transcriptional network that is similar in both groups and involves OCt4, Nanog and Sox2. The three transcription factors and their downstream target genes coordinately promote self-renewal and pluripotency. |
| hsa05202 | Transcriptional misregulation in cancer | In tumor cells, genes encoding transcription factors (TFs) are often amplified, deleted, rearranged via chromosomal translocation and inversion, or subjected to point mutations that result in a gain- or loss-of- function. In hematopoietic cancers and solid tumors, the translocations and inversions increase or deregulate transcription of the oncogene. Recurrent chromosome translocations generate novel fusion oncoproteins, which are common in myeloid cancers and soft-tissue sarcomas. The fusion proteins have aberrant transcriptional function compared to their wild-type counterparts. These fusion transcription factors alter expression of target genes, and thereby result in a variety of altered cellular properties that contribute to the tumourigenic process. |
| Pathway ID | Pathway Name | Pathway Description (KEGG) |
| R-HSA-201451 | Signaling by BMP. | Bone morphogenetic proteins (BMPs) have many biological activities in various tissues, including bone, cartilage, blood vessels, heart, kidney, neurons, liver and lung. They are members of the Transforming growth factor-Beta (TGFB) family. They bind to type II and type I serine-threonine kinase receptors, which transduce signals through SMAD and non-SMAD signalling pathways. BMP signalling is linked to a wide variety of clinical disorders, including vascular diseases, skeletal diseases and cancer. BMPs typically activate BMP type I receptors and signal via SMAD1, 5 and 8. They can be classified into several subgroups, including the BMP2/4 group, the BMP5-8 osteogenic protein-1 (OP1) group, the growth and differentiation factor (GDF) 5-7 group and the BMP9/10 group. Most of the proteins of the BMP2/4, OP1 and BMP9/10 groups induce formation of bone and cartilage tissues in vivo, while the GDF5-7 group induce cartilage and tendon-like, but not bone-like, tissues (Miyazono et al. 2010). Members of the TGFB family bind to two types of serine-threonine kinase receptors, type I and type II (Massagué 2012). BMPs can bind type I receptors in the absence of type II receptors, but both types are required for signal transduction. The presence of both types dramatically increases binding affinity (Rozenweig et al. 1995). The type II receptor kinase transphosphorylates the type I receptor, which transmits specific intracellular signals. Type I and type II receptors share similar structural properties, comprised of a relatively short extracellular domain, a single membrane-spanning domain and an intracellular domain containing a serine-threonine kinase domain. Seven receptors, collectively referred to as the Activin receptor-like kinases (ALK), have been identified as type I receptors for the TGFB family in mammals. ALKs are classified into three groups based on their structure and function, the BMPRI group (Bone morphogenetic protein receptor type-1A, ALK3, BMPR1A and Bone morphogenetic protein receptor type-1B, ALK6, BMPR1B), the ALK1 group (Serine/threonine-protein kinase receptor R3, ALK1, ACVRL1 and Activin receptor type-1, ALK2, ACVR1) and the TBetaR1 group (Activin receptor type-1B, ALK4, ACVR1B and TGF-beta receptor type-1, ALK5, TGFBR1 and Activin receptor type-1C, ALK7, ACVR1C) (Kawabata et al. 1998). ALK1 group and BMPRI group activate SMAD1/5/8 and transduce similar intracellular signals. The TBetaR1 group activate SMAD2/3. BMPR1A and ACVR1 are widely expressed. BMPR1B shows a more restricted expression profile. ACVRL1 is limited to endothelial cells and a few other cell types. The binding specificities of BMPs to type I receptors is affected by the type II receptors that are present (Yu et al. 2005). Typically, BMP2 and BMP4 bind to BMPR1A and BMPR1B (ten Dijke et al. 1994). BMP6 and BMP7 bind strongly to ACVR1 and weakly to BMPR1B. Growth/differentiation factor 5 (BMP14, GDF5) preferentially binds to BMPR1B, but not to other type I receptors (Nishitoh et al. 1995). BMP9 and BMP10 bind to ACVRL1 and ACVRL (Scharpfenecker et al. 2007). BMP type I receptors are shared by other members of the TGFB family. Three receptors, Bone morphogenetic protein receptor type-2 (BMPR2), Activin receptor type-2A (ACVR2A) and Activin receptor type-2B (ACVR2B) are the type II receptors for mammalian BMPs. They are widely expressed in various tissues. BMPR2 is specific for BMPs, whereas ACVR2A and ACVR2B are shared with activins and myostatin. BMP binding and signalling can be affected by coreceptors. Glycosylphosphatidylinositol (GPI)-anchored proteins of the repulsive guidance molecule (RGM) family, including RGMA, RGMB (DRAGON) and Hemojuvelin (HFE2, RGMC) are coreceptors for BMP2 and BMP4, enhancing signaling (Samad et al. 2005, Babitt et al. 2005, 2006). They interact with BMP type I and/or type II receptors and bind BMP2 and BMP4, but not BMP7 or TGFB1. BMP2/4 signalling normally involves BMPR2, not ACVR2A or ACVR2B. Cells transfected with RGMA use both BMPR2 and ACVR2A for BMP-2/4 signalling, suggesting that RGMA facilitates the use of ACVR2A by BMP2/4 (Xia et al. 2007). Endoglin (ENG) is a transmembrane protein expressed in proliferating endothelial cells. It binds various ligands including TGFB1/3, Activin-A and BMP2/7 (Barbara et al. 1999). It inhibits TGFB-induced responses and enhances BMP7-induced responses (Scherner et al. 2007). Mutations in ENG result in hereditary haemorrhagic telangiectasia (HHT1), also known as OslerWeberRendu disease, while mutations in ACVRL1 lead to HHT2, suggesting that they act in a common signalling pathway (McAllister et al. 1994, Johnson et al. 1996). BMP2 is a dimeric protein, having two receptor-binding motifs. One is a high-affinity binding site for BMPR1A, the other is a low-affinity binding site for BMPR2 (Kirsch et al. 2000). In the absence of ligand stimulation, small fractions of type II and type I receptors are present as preexisting homodimers and heterodimers on the cell surface. Ligand-binding increases oligomerization. The intracellular domains of type I receptors have a characteristic GS domain (glycine and serine-rich domain) located N-terminal to the serine-threonine kinase domains. Type II receptor kinases are constitutively active in the absence of ligand. Upon ligand binding, the type II receptor kinase phosphorylates the GS domain of the type I receptor, a critical event in signal transduction by the serine/threonine kinase receptors (Miyazono et al. 2010). Activation of the TGFBR1 receptor has been studied in detail. The inactive conformation is maintained by interaction between the GS domain, the N-terminal lobe and the activation loop of the kinase (Huse et al. 1999). When the GS domain is phosphorylated by the type II receptor kinase, the TGFBR1 kinase is converted to an active conformation. Mutations of Thr-204 in TGFBR1 and the corresponding Gln in BMP type I receptors lead to their constitutive activation. The L45 loop, in the kinase domain of type I receptors, specifically interacts with receptor-regulated Smads (R-Smads). Neurotrophic tyrosine kinase receptor type 3 (NT-3 growth factor receptor, TrkC, NTRK3) directly binds BMPR2, interfereing with its interaction with BMPR1A, which inhibits downstream signalling (Jin et al. 2007). Tyrosine-protein kinase transmembrane receptor ROR2 and BMPR1B form a heteromeric complex in a ligand independent fashion that modulatesGDF5-BMPR1B signalling by inhibition of Smad1/5 signalling (Sammar et al. 2004). Type I receptor kinases activated by the type II receptor kinases, phosphorylate R-Smads. R-Smads then form a complex with common-partner Smad (co-Smad) and translocate to the nucleus. The oligomeric Smad complexes regulate the transcription of target genes through interaction with various transcription factors and transcriptional coactivators or corepressors. Inhibitory Smads (I-Smads) negatively regulate the action of R-Smads and/or co-Smads. Eight different Smads have been identified in mammals. Smad1, Smad5 and Smad8 are R-Smads in BMP signalling pathways (BMP-specific R-Smads). Smad2 and Smad3 are R-Smads in TGFB/activinsignalling pathways. BMP receptors can phosphorylate Smad2 in certain types of cells (Murakami et al. 2009). Smad1, Smad5 and Smad8 are structurally highly similar to each other. The functional differences between them are largely unknown. Smad4 is the only co-Smad in mammals, shared by both BMP and TGFB/activin signalling pathways. Smad6 and Smad7 are I-Smads |
| R-HSA-5689880 | Ub-specific processing proteases. | Ub-specific processing proteases (USPs) are the largest of the DUB families with more than 50 members in humans. The USP catalytic domain varies considerably in size and consists of six conserved motifs with N- or C-terminal extensions and insertions occurring between the conserved motifs (Ye et al. 2009). Two highly conserved regions comprise the catalytic triad, the Cys-box (Cys) and His-box (His and Asp/Asn) (Nijman et al. 2005, Ye et al. 2009, Reyes-Turcu & Wilkinson 2009). They recognize their substrates by interactions of the variable regions with the substrate protein directly, or via scaffolds or adapters in multiprotein complexes |
| R-HSA-8941326 | RUNX2 regulates bone development. | RUNX2 is required for the development of both intramembraneous and endochondral bones through regulation of osteoblast differentiation and chondrocyte maturation, respectively. In its absence, intramembraneous ossification is blocked while endochondral ossification is arrested at the cartilaginous stage (Otto et al. 1997, Komori et al. 1997). In mice and humans, RUNX2 haploinsufficiency causes Cleidocranial dysplasia, a generalized bone disorder (Otto et al. 1997, Lee et al. 1997).RUNX2 stimulates transcription of most of the genes constituting the bone extracellular matrix and of BGLAP gene, which encodes Osteocalcin, a bone-derived hormone controlling glucose metabolism, male fertility and cognition (Ducy et al. 1997).RUNX2 promotes chondrocyte maturation by stimulating transcription of the IHH gene, encoding Indian hedgehog (Takeda et al. 2001, Yoshida et al. 2004).In response to BMP2 signaling, RUNX2 forms a complex with SMAD1:SMAD4 heterotrimer in the nucleus and stimulates transcription of SMAD6 (Wang et al. 2007).RBM14, a negative regulator of RUNX2 transcriptional activity, is frequently overexpressed in osteosarcoma (Li et al. 2009) |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACVR1 | Affinity Capture-Western | physical | 10652350, 9748228, (Europe PMC) | NA | BioGRID |
| ACVRL1 | Biochemical Activity | physical | 19592636, (Europe PMC) | NA | BioGRID |
| AKR1B1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ANKRD27 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| AP2A2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| APP | Reconstituted Complex | physical | 21832049, (Europe PMC) | NA | BioGRID |
| AR | Affinity Capture-Western, Co-localization, PCA, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, protein complementation assay | colocalization, physical, physical association | 17183365, 23734213, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| BMP7 | Phenotypic Suppression | genetic | 11438941, (Europe PMC) | NA | BioGRID |
| BMPR1A | Biochemical Activity, two hybrid array | physical, physical association | 24412244, 9136927, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CAMSAP1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CDK7 | Biochemical Activity | physical | 19914168, (Europe PMC) | NA | BioGRID |
| CDK8 | Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation | physical, physical association | 19914168, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CDK9 | Biochemical Activity | physical | 19914168, (Europe PMC) | NA | BioGRID |
| CHMP3 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CREBBP | Affinity Capture-Western | physical | 10673036, 11239394, (Europe PMC) | NA | BioGRID |
| DNMT3L | Reconstituted Complex | physical | 24952347, (Europe PMC) | NA | BioGRID |
| DVL1 | Reconstituted Complex | physical | 12650946, (Europe PMC) | NA | BioGRID |
| EP300 | Affinity Capture-Western | physical | 10205054, 10673036, 16613856, 20851880, 22365546, (Europe PMC) | NA | BioGRID |
| ERBIN | Reconstituted Complex | physical | 12650946, (Europe PMC) | NA | BioGRID |
| FOXG1 | Reconstituted Complex | physical | 11387330, (Europe PMC) | NA | BioGRID |
| FOXO3 | Affinity Capture-Western | physical | 17289590, (Europe PMC) | NA | BioGRID |
| FRZB | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GLI3 | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| GMEB1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GSK3B | Biochemical Activity, Co-localization, protein kinase assay, proximity ligation assay | phosphorylation reaction, physical, physical association | 18045539, 25241761, (Europe PMC) | 0.61 | BioGRID, IntAct |
| HBP1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| HDAC1 | Affinity Capture-Western | physical | 14699069, (Europe PMC) | NA | BioGRID |
| HGS | Affinity Capture-Western | physical | 11094085, (Europe PMC) | NA | BioGRID |
| HIPK2 | Affinity Capture-Western, Reconstituted Complex | physical | 12874272, (Europe PMC) | NA | BioGRID |
| HMGA2 | Affinity Capture-Western | physical | 18425117, (Europe PMC) | NA | BioGRID |
| HOXA5 | Two-hybrid | physical | 20211142, (Europe PMC) | NA | BioGRID |
| HOXC8 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 10224145, (Europe PMC) | NA | BioGRID |
| ICK | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| INPP4A | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| IRF2BP1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| KAT2A | Affinity Capture-Western | physical | 15009097, (Europe PMC) | NA | BioGRID |
| KDM6B | Affinity Capture-Western | physical | 20667911, (Europe PMC) | NA | BioGRID |
| KMT2D | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| LEF1 | Affinity Capture-Western | physical | 15750622, (Europe PMC) | NA | BioGRID |
| LEMD3 | Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach | physical, physical association | 15231748, 15489854, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| LMNA | Two-hybrid | physical | 24623722, (Europe PMC) | NA | BioGRID |
| MAPK1 | Biochemical Activity | physical | 17289590, 18045539, 19914168, (Europe PMC) | NA | BioGRID |
| MAST4 | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| MECOM | Reconstituted Complex | physical | 15849193, (Europe PMC) | NA | BioGRID |
| MED15 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 12167862, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MED24 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 12167862, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MED6 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 12167862, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MEN1 | Affinity Capture-Western | physical | 12649288, (Europe PMC) | NA | BioGRID |
| MGA | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MRTFB | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| NEDD4 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 15231748, 21308777, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NEDD9 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 11118211, 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NEUROG1 | Phenotypic Enhancement, Phenotypic Suppression, Reconstituted Complex | genetic, physical | 11239394, (Europe PMC) | NA | BioGRID |
| NKX3-2 | Affinity Capture-Western, Reconstituted Complex | physical | 14612411, (Europe PMC) | NA | BioGRID |
| NOTCH2 | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| NUP214 | Affinity Capture-Western | physical | 17289590, (Europe PMC) | NA | BioGRID |
| OAZ1 | Two-hybrid | physical | 11571290, (Europe PMC) | NA | BioGRID |
| OAZ3 | Two-hybrid | physical | 11438941, (Europe PMC) | NA | BioGRID |
| PARD3 | Reconstituted Complex | physical | 12650946, (Europe PMC) | NA | BioGRID |
| PAX6 | Affinity Capture-Western | physical | 17251190, (Europe PMC) | NA | BioGRID |
| PIAS1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PIAS4 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 12904571, 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PIGQ | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PPM1A | Affinity Capture-Western | physical | 22588298, (Europe PMC) | NA | BioGRID |
| PSMB4 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 11438941, 11571290, 12097147, 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PSMD1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PSMD11 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PUM1 | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| RFX1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RUNX1 | Affinity Capture-Western | physical | 10531362, (Europe PMC) | NA | BioGRID |
| RUNX2 | Affinity Capture-Western, Co-localization | physical | 10531362, 10962029, 17215250, 20851880, (Europe PMC) | NA | BioGRID |
| RUNX3 | Affinity Capture-Western | physical | 10531362, (Europe PMC) | NA | BioGRID |
| SF3B1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SKI | Affinity Capture-Western, Reconstituted Complex | physical | 12426322, 12874272, 14699069, (Europe PMC) | NA | BioGRID |
| SKIL | Affinity Capture-Western | physical | 12426322, (Europe PMC) | NA | BioGRID |
| SMAD1 | Two-hybrid, cosedimentation through density gradient, molecular sieving, two hybrid, x-ray crystallography | direct interaction, physical, physical association | 11779505, 15231748, 9111321, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| SMAD2 | Affinity Capture-MS, Two-hybrid | physical | 18729074, 9111321, (Europe PMC) | NA | BioGRID |
| SMAD3 | Affinity Capture-MS, Two-hybrid | physical | 18729074, 9111321, (Europe PMC) | NA | BioGRID |
| SMAD4 | Affinity Capture-Luminescence, Affinity Capture-Western, Co-fractionation, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, molecular sieving, two hybrid, two hybrid array, two hybrid prey pooling approach | association, direct interaction, physical, physical association | 10531362, 11700304, 11779505, 12167862, 12874272, 14701756, 15231748, 15761153, 17183365, 21454478, 24412244, 26555259, 28468752, 9111321, 9436979, (Europe PMC) | 0.91 | BioGRID, IntAct, MINT |
| SMAD5 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SMAD6 | Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, two hybrid | association, physical, physical association | 11483516, 12857866, 9256479, 9436979, (Europe PMC) | 0.57 | BioGRID, IntAct |
| SMAD7 | Affinity Capture-Western | physical | 26555259, (Europe PMC) | NA | BioGRID |
| SMARCE1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SMURF1 | Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Protein-peptide, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, pull down, two hybrid | direct interaction, physical, physical association | 14701756, 15221015, 15231748, 16611643, 17289590, 17510966, 17676934, 19914168, 19917253, 21685363, 21708152, 22152476, 22670624, 24828823, 28881580, (Europe PMC) | 0.54, 0.57 | BioGRID, IntAct, MINT |
| SMURF2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, nuclear magnetic resonance, two hybrid, two hybrid array, two hybrid prey pooling approach | direct interaction, physical, physical association | 11016919, 11158580, 14701756, 15221015, 15231748, 20937913, 28468752, 28514442, (Europe PMC) | 0.73 | BioGRID, IntAct, MINT |
| SNIP1 | Two-hybrid | physical | 10887155, (Europe PMC) | NA | BioGRID |
| SNRNP70 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SOX5 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SS18L1 | Two-hybrid | physical | 20211142, (Europe PMC) | NA | BioGRID |
| STARD13 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| STAT3 | Affinity Capture-Western | physical | 10205054, (Europe PMC) | NA | BioGRID |
| STUB1 | Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Reconstituted Complex, Two-hybrid | physical | 14701756, 21454478, 23344957, (Europe PMC) | NA | BioGRID |
| TCF20 | Two-hybrid | physical | 20211142, (Europe PMC) | NA | BioGRID |
| TGIF1 | Affinity Capture-Western | physical | 10199400, (Europe PMC) | NA | BioGRID |
| TOB1 | Affinity Capture-Western | physical | 11163184, (Europe PMC) | NA | BioGRID |
| TP53 | Affinity Capture-Western | physical | 22588298, (Europe PMC) | NA | BioGRID |
| TTF1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TTF2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| UBC | Two-hybrid | physical | 11438941, (Europe PMC) | NA | BioGRID |
| UCHL3 | Affinity Capture-Western, anti tag coimmunoprecipitation | physical, physical association | 21453705, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| USP15 | Affinity Capture-Western | physical | 21947082, 22344298, (Europe PMC) | NA | BioGRID |
| USP9X | Affinity Capture-Western | physical | 19135894, (Europe PMC) | NA | BioGRID |
| WDR77 | Affinity Capture-Western, Two-hybrid | physical | 23734213, (Europe PMC) | NA | BioGRID |
| WWP1 | Affinity Capture-Western | physical | 15221015, 15359284, (Europe PMC) | NA | BioGRID |
| XPC | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| YAP1 | Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti tag coimmunoprecipitation, isothermal titration calorimetry | direct interaction, physical, physical association | 19914168, 21685363, (Europe PMC) | 0.54 | BioGRID, IntAct |
| YY1 | Reconstituted Complex | physical | 12808092, (Europe PMC) | NA | BioGRID |
| ZCCHC12 | Affinity Capture-Western, Reconstituted Complex | physical | 18160706, 19416967, (Europe PMC) | NA | BioGRID |
| ZDHHC3 | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| ZEB1 | Affinity Capture-Western | physical | 12743038, (Europe PMC) | NA | BioGRID |
| ZEB2 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 15231748, 22365546, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF251 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF423 | Affinity Capture-Western | physical | 10660046, 14630787, (Europe PMC) | NA | BioGRID |
| ZNF510 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF512B | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF521 | Affinity Capture-Western | physical | 14630787, (Europe PMC) | NA | BioGRID |
| ZNF76 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZSCAN4 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AKR1B1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ANKRD27 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| AP2A2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| APC | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| AR | Affinity Capture-Western, Co-localization, PCA, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, protein complementation assay | colocalization, physical, physical association | 17183365, 23734213, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| AXIN2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| BMPR1A | Biochemical Activity, two hybrid array | physical, physical association | 24412244, 9136927, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| BUB1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| CAMSAP1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CCNC | protein kinase assay | phosphorylation reaction | 19914168, (Europe PMC) | 0.44 | IntAct |
| CCND1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| CCNT1 | protein kinase assay | phosphorylation reaction | 19914168, (Europe PMC) | 0.44 | IntAct |
| CDK8 | Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation | physical, physical association | 19914168, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CHMP3 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CTDSP1 | anti tag coimmunoprecipitation | physical association | 16882717, (Europe PMC) | 0.40 | IntAct |
| CTDSP2 | anti tag coimmunoprecipitation | physical association | 16882717, (Europe PMC) | 0.40 | IntAct |
| CTDSPL | anti tag coimmunoprecipitation | physical association | 16882717, (Europe PMC) | 0.40 | IntAct |
| CTNNA1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| DDX5 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down | association, physical association | 18548003, (Europe PMC) | 0.61 | IntAct |
| DLC1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| DROSHA | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down | association, physical association | 18548003, (Europe PMC) | 0.56 | IntAct |
| ERBB2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| FBXW7 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| FRZB | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GLI3 | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| GMEB1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GSK3B | Biochemical Activity, Co-localization, protein kinase assay, proximity ligation assay | phosphorylation reaction, physical, physical association | 18045539, 25241761, (Europe PMC) | 0.61 | BioGRID, IntAct |
| HBP1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ICK | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| INPP4A | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| IRF2BP1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| KMT2B | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| LEMD3 | Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach | physical, physical association | 15231748, 15489854, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| MAST4 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| MED15 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 12167862, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MED24 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 12167862, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MED6 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 12167862, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MGA | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MKL2 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| MLH1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| MLH3 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| MSH2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| MUTYH | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| NEDD4 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 15231748, 21308777, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NEDD9 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 11118211, 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NOTCH2 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| NRAS | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| PDGFRL | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| PIAS1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PIAS4 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 12904571, 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PIGQ | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PSMB4 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 11438941, 11571290, 12097147, 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PSMD1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PSMD11 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PTPN12 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| PUM1 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| RFX1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SF3B1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SMAD1 | Two-hybrid, cosedimentation through density gradient, molecular sieving, two hybrid, x-ray crystallography | direct interaction, physical, physical association | 11779505, 15231748, 9111321, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| SMAD4 | Affinity Capture-Luminescence, Affinity Capture-Western, Co-fractionation, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, molecular sieving, two hybrid, two hybrid array, two hybrid prey pooling approach | association, direct interaction, physical, physical association | 10531362, 11700304, 11779505, 12167862, 12874272, 14701756, 15231748, 15761153, 17183365, 21454478, 24412244, 26555259, 28468752, 9111321, 9436979, (Europe PMC) | 0.91 | BioGRID, IntAct, MINT |
| SMAD5 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SMAD6 | Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, two hybrid | association, physical, physical association | 11483516, 12857866, 9256479, 9436979, (Europe PMC) | 0.57 | BioGRID, IntAct |
| SMARCE1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SMURF1 | Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Protein-peptide, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, pull down, two hybrid | direct interaction, physical, physical association | 14701756, 15221015, 15231748, 16611643, 17289590, 17510966, 17676934, 19914168, 19917253, 21685363, 21708152, 22152476, 22670624, 24828823, 28881580, (Europe PMC) | 0.54, 0.57 | BioGRID, IntAct, MINT |
| SMURF2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, nuclear magnetic resonance, two hybrid, two hybrid array, two hybrid prey pooling approach | direct interaction, physical, physical association | 11016919, 11158580, 14701756, 15221015, 15231748, 20937913, 28468752, 28514442, (Europe PMC) | 0.73 | BioGRID, IntAct, MINT |
| SNRNP70 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SOX5 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| STARD13 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TLR2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| TTF1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TTF2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TUBA4A | anti bait coimmunoprecipitation | physical association | 17183365, (Europe PMC) | 0.40 | IntAct, MINT |
| UCHL3 | Affinity Capture-Western, anti tag coimmunoprecipitation | physical, physical association | 21453705, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| XPC | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| YAP1 | Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti tag coimmunoprecipitation, isothermal titration calorimetry | direct interaction, physical, physical association | 19914168, 21685363, (Europe PMC) | 0.54 | BioGRID, IntAct |
| ZDHHC3 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| ZEB2 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 15231748, 22365546, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF251 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF510 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF512B | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF76 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZSCAN4 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| AKR1B1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ANKRD27 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| AP2A2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| APC | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| AR | Affinity Capture-Western, Co-localization, PCA, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, protein complementation assay | colocalization, physical, physical association | 17183365, 23734213, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| AXIN2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| BMPR1A | Biochemical Activity, two hybrid array | physical, physical association | 24412244, 9136927, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| BUB1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| CAMSAP1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CCND1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| CHMP3 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CTNNA1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| DLC1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| ERBB2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| FBXW7 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| FRZB | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GMEB1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| HBP1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ICK | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| INPP4A | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| IRF2BP1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| KMT2B | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| LEMD3 | Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach | physical, physical association | 15231748, 15489854, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| MAST4 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| MED15 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 12167862, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MED24 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 12167862, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MED6 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 12167862, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MGA | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MKL2 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| MLH1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| MLH3 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| MSH2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| MUTYH | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| NEDD4 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 15231748, 21308777, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NEDD9 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 11118211, 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NOTCH2 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| NRAS | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| PDGFRL | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| PIAS1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PIAS4 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 12904571, 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PIGQ | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PSMB4 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 11438941, 11571290, 12097147, 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PSMD1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PSMD11 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PTPN12 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| PUM1 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| RFX1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SF3B1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SMAD1 | Two-hybrid, cosedimentation through density gradient, molecular sieving, two hybrid, x-ray crystallography | direct interaction, physical, physical association | 11779505, 15231748, 9111321, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| SMAD4 | Affinity Capture-Luminescence, Affinity Capture-Western, Co-fractionation, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, molecular sieving, two hybrid, two hybrid array, two hybrid prey pooling approach | association, direct interaction, physical, physical association | 10531362, 11700304, 11779505, 12167862, 12874272, 14701756, 15231748, 15761153, 17183365, 21454478, 24412244, 26555259, 28468752, 9111321, 9436979, (Europe PMC) | 0.91 | BioGRID, IntAct, MINT |
| SMAD5 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SMARCE1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SMURF1 | Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Protein-peptide, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, pull down, two hybrid | direct interaction, physical, physical association | 14701756, 15221015, 15231748, 16611643, 17289590, 17510966, 17676934, 19914168, 19917253, 21685363, 21708152, 22152476, 22670624, 24828823, 28881580, (Europe PMC) | 0.54, 0.57 | BioGRID, IntAct, MINT |
| SMURF2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, nuclear magnetic resonance, two hybrid, two hybrid array, two hybrid prey pooling approach | direct interaction, physical, physical association | 11016919, 11158580, 14701756, 15221015, 15231748, 20937913, 28468752, 28514442, (Europe PMC) | 0.73 | BioGRID, IntAct, MINT |
| SNRNP70 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SOX5 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| STARD13 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TLR2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| TTF1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TTF2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TUBA4A | anti bait coimmunoprecipitation | physical association | 17183365, (Europe PMC) | 0.40 | IntAct, MINT |
| UCHL3 | Affinity Capture-Western, anti tag coimmunoprecipitation | physical, physical association | 21453705, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| XPC | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZDHHC3 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| ZEB2 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 15231748, 22365546, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF251 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF510 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF512B | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF76 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZSCAN4 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| Interacting partner | Detection method | Interaction type | PubMed IDs | Interaction Score | Source |
| ACVR1 | Affinity Capture-Western | physical | 10652350, 9748228, (Europe PMC) | NA | BioGRID |
| ACVRL1 | Biochemical Activity | physical | 19592636, (Europe PMC) | NA | BioGRID |
| AKR1B1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ANKRD27 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| AP2A2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| APC | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| APP | Reconstituted Complex | physical | 21832049, (Europe PMC) | NA | BioGRID |
| AR | Affinity Capture-Western, Co-localization, PCA, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, protein complementation assay | colocalization, physical, physical association | 17183365, 23734213, (Europe PMC) | 0.60 | BioGRID, IntAct, MINT |
| AXIN2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| BMP7 | Phenotypic Suppression | genetic | 11438941, (Europe PMC) | NA | BioGRID |
| BMPR1A | Biochemical Activity, two hybrid array | physical, physical association | 24412244, 9136927, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| BUB1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| CAMSAP1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CCNC | protein kinase assay | phosphorylation reaction | 19914168, (Europe PMC) | 0.44 | IntAct |
| CCND1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| CCNT1 | protein kinase assay | phosphorylation reaction | 19914168, (Europe PMC) | 0.44 | IntAct |
| CDK7 | Biochemical Activity | physical | 19914168, (Europe PMC) | NA | BioGRID |
| CDK8 | Affinity Capture-Western, Biochemical Activity, anti tag coimmunoprecipitation | physical, physical association | 19914168, (Europe PMC) | 0.40 | BioGRID, IntAct |
| CDK9 | Biochemical Activity | physical | 19914168, (Europe PMC) | NA | BioGRID |
| CHMP3 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| CREBBP | Affinity Capture-Western | physical | 10673036, 11239394, (Europe PMC) | NA | BioGRID |
| CTDSP1 | anti tag coimmunoprecipitation | physical association | 16882717, (Europe PMC) | 0.40 | IntAct |
| CTDSP2 | anti tag coimmunoprecipitation | physical association | 16882717, (Europe PMC) | 0.40 | IntAct |
| CTDSPL | anti tag coimmunoprecipitation | physical association | 16882717, (Europe PMC) | 0.40 | IntAct |
| CTNNA1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| DDX5 | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down | association, physical association | 18548003, (Europe PMC) | 0.61 | IntAct |
| DLC1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| DNMT3L | Reconstituted Complex | physical | 24952347, (Europe PMC) | NA | BioGRID |
| DROSHA | anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down | association, physical association | 18548003, (Europe PMC) | 0.56 | IntAct |
| DVL1 | Reconstituted Complex | physical | 12650946, (Europe PMC) | NA | BioGRID |
| EP300 | Affinity Capture-Western | physical | 10205054, 10673036, 16613856, 20851880, 22365546, (Europe PMC) | NA | BioGRID |
| ERBB2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| ERBIN | Reconstituted Complex | physical | 12650946, (Europe PMC) | NA | BioGRID |
| FBXW7 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| FOXG1 | Reconstituted Complex | physical | 11387330, (Europe PMC) | NA | BioGRID |
| FOXO3 | Affinity Capture-Western | physical | 17289590, (Europe PMC) | NA | BioGRID |
| FRZB | Two-hybrid, two hybrid | physical, physical association | 21900206, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GLI3 | Co-localization, proximity ligation assay | physical, physical association | 25241761, (Europe PMC) | 0.40 | BioGRID, IntAct |
| GMEB1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| GSK3B | Biochemical Activity, Co-localization, protein kinase assay, proximity ligation assay | phosphorylation reaction, physical, physical association | 18045539, 25241761, (Europe PMC) | 0.61 | BioGRID, IntAct |
| HBP1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| HDAC1 | Affinity Capture-Western | physical | 14699069, (Europe PMC) | NA | BioGRID |
| HGS | Affinity Capture-Western | physical | 11094085, (Europe PMC) | NA | BioGRID |
| HIPK2 | Affinity Capture-Western, Reconstituted Complex | physical | 12874272, (Europe PMC) | NA | BioGRID |
| HMGA2 | Affinity Capture-Western | physical | 18425117, (Europe PMC) | NA | BioGRID |
| HOXA5 | Two-hybrid | physical | 20211142, (Europe PMC) | NA | BioGRID |
| HOXC8 | Affinity Capture-Western, Reconstituted Complex, Two-hybrid | physical | 10224145, (Europe PMC) | NA | BioGRID |
| ICK | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| INPP4A | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| IRF2BP1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| KAT2A | Affinity Capture-Western | physical | 15009097, (Europe PMC) | NA | BioGRID |
| KDM6B | Affinity Capture-Western | physical | 20667911, (Europe PMC) | NA | BioGRID |
| KMT2B | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| KMT2D | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| LEF1 | Affinity Capture-Western | physical | 15750622, (Europe PMC) | NA | BioGRID |
| LEMD3 | Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach | physical, physical association | 15231748, 15489854, (Europe PMC) | 0.62 | BioGRID, IntAct, MINT |
| LMNA | Two-hybrid | physical | 24623722, (Europe PMC) | NA | BioGRID |
| MAPK1 | Biochemical Activity | physical | 17289590, 18045539, 19914168, (Europe PMC) | NA | BioGRID |
| MAST4 | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| MAST4 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| MECOM | Reconstituted Complex | physical | 15849193, (Europe PMC) | NA | BioGRID |
| MED15 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 12167862, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MED24 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 12167862, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MED6 | Affinity Capture-Western, coimmunoprecipitation | physical, physical association | 12167862, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| MEN1 | Affinity Capture-Western | physical | 12649288, (Europe PMC) | NA | BioGRID |
| MGA | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| MKL2 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| MLH1 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| MLH3 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| MRTFB | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| MSH2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| MUTYH | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| NEDD4 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 15231748, 21308777, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NEDD9 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 11118211, 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| NEUROG1 | Phenotypic Enhancement, Phenotypic Suppression, Reconstituted Complex | genetic, physical | 11239394, (Europe PMC) | NA | BioGRID |
| NKX3-2 | Affinity Capture-Western, Reconstituted Complex | physical | 14612411, (Europe PMC) | NA | BioGRID |
| NOTCH2 | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| NOTCH2 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| NRAS | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| NUP214 | Affinity Capture-Western | physical | 17289590, (Europe PMC) | NA | BioGRID |
| OAZ1 | Two-hybrid | physical | 11571290, (Europe PMC) | NA | BioGRID |
| OAZ3 | Two-hybrid | physical | 11438941, (Europe PMC) | NA | BioGRID |
| PARD3 | Reconstituted Complex | physical | 12650946, (Europe PMC) | NA | BioGRID |
| PAX6 | Affinity Capture-Western | physical | 17251190, (Europe PMC) | NA | BioGRID |
| PDGFRL | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| PIAS1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PIAS4 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 12904571, 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PIGQ | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PPM1A | Affinity Capture-Western | physical | 22588298, (Europe PMC) | NA | BioGRID |
| PSMB4 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 11438941, 11571290, 12097147, 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PSMD1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PSMD11 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| PTPN12 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| PUM1 | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| PUM1 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| RFX1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| RUNX1 | Affinity Capture-Western | physical | 10531362, (Europe PMC) | NA | BioGRID |
| RUNX2 | Affinity Capture-Western, Co-localization | physical | 10531362, 10962029, 17215250, 20851880, (Europe PMC) | NA | BioGRID |
| RUNX3 | Affinity Capture-Western | physical | 10531362, (Europe PMC) | NA | BioGRID |
| SF3B1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SKI | Affinity Capture-Western, Reconstituted Complex | physical | 12426322, 12874272, 14699069, (Europe PMC) | NA | BioGRID |
| SKIL | Affinity Capture-Western | physical | 12426322, (Europe PMC) | NA | BioGRID |
| SMAD1 | Two-hybrid, cosedimentation through density gradient, molecular sieving, two hybrid, x-ray crystallography | direct interaction, physical, physical association | 11779505, 15231748, 9111321, (Europe PMC) | 0.71 | BioGRID, IntAct, MINT |
| SMAD2 | Affinity Capture-MS, Two-hybrid | physical | 18729074, 9111321, (Europe PMC) | NA | BioGRID |
| SMAD3 | Affinity Capture-MS, Two-hybrid | physical | 18729074, 9111321, (Europe PMC) | NA | BioGRID |
| SMAD4 | Affinity Capture-Luminescence, Affinity Capture-Western, Co-fractionation, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, molecular sieving, two hybrid, two hybrid array, two hybrid prey pooling approach | association, direct interaction, physical, physical association | 10531362, 11700304, 11779505, 12167862, 12874272, 14701756, 15231748, 15761153, 17183365, 21454478, 24412244, 26555259, 28468752, 9111321, 9436979, (Europe PMC) | 0.91 | BioGRID, IntAct, MINT |
| SMAD5 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SMAD6 | Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, two hybrid | association, physical, physical association | 11483516, 12857866, 9256479, 9436979, (Europe PMC) | 0.57 | BioGRID, IntAct |
| SMAD7 | Affinity Capture-Western | physical | 26555259, (Europe PMC) | NA | BioGRID |
| SMARCE1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SMURF1 | Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Protein-peptide, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, pull down, two hybrid | direct interaction, physical, physical association | 14701756, 15221015, 15231748, 16611643, 17289590, 17510966, 17676934, 19914168, 19917253, 21685363, 21708152, 22152476, 22670624, 24828823, 28881580, (Europe PMC) | 0.54, 0.57 | BioGRID, IntAct, MINT |
| SMURF2 | Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, nuclear magnetic resonance, two hybrid, two hybrid array, two hybrid prey pooling approach | direct interaction, physical, physical association | 11016919, 11158580, 14701756, 15221015, 15231748, 20937913, 28468752, 28514442, (Europe PMC) | 0.73 | BioGRID, IntAct, MINT |
| SNIP1 | Two-hybrid | physical | 10887155, (Europe PMC) | NA | BioGRID |
| SNRNP70 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SOX5 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| SS18L1 | Two-hybrid | physical | 20211142, (Europe PMC) | NA | BioGRID |
| STARD13 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| STAT3 | Affinity Capture-Western | physical | 10205054, (Europe PMC) | NA | BioGRID |
| STUB1 | Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Reconstituted Complex, Two-hybrid | physical | 14701756, 21454478, 23344957, (Europe PMC) | NA | BioGRID |
| TCF20 | Two-hybrid | physical | 20211142, (Europe PMC) | NA | BioGRID |
| TGIF1 | Affinity Capture-Western | physical | 10199400, (Europe PMC) | NA | BioGRID |
| TLR2 | two hybrid array | physical association | 24412244, (Europe PMC) | 0.37 | IntAct, MINT |
| TOB1 | Affinity Capture-Western | physical | 11163184, (Europe PMC) | NA | BioGRID |
| TP53 | Affinity Capture-Western | physical | 22588298, (Europe PMC) | NA | BioGRID |
| TTF1 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TTF2 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| TUBA4A | anti bait coimmunoprecipitation | physical association | 17183365, (Europe PMC) | 0.40 | IntAct, MINT |
| UBC | Two-hybrid | physical | 11438941, (Europe PMC) | NA | BioGRID |
| UCHL3 | Affinity Capture-Western, anti tag coimmunoprecipitation | physical, physical association | 21453705, (Europe PMC) | 0.40 | BioGRID, IntAct, MINT |
| USP15 | Affinity Capture-Western | physical | 21947082, 22344298, (Europe PMC) | NA | BioGRID |
| USP9X | Affinity Capture-Western | physical | 19135894, (Europe PMC) | NA | BioGRID |
| WDR77 | Affinity Capture-Western, Two-hybrid | physical | 23734213, (Europe PMC) | NA | BioGRID |
| WWP1 | Affinity Capture-Western | physical | 15221015, 15359284, (Europe PMC) | NA | BioGRID |
| XPC | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| XPO1 | Affinity Capture-MS | physical | 26673895, (Europe PMC) | NA | BioGRID |
| YAP1 | Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti tag coimmunoprecipitation, isothermal titration calorimetry | direct interaction, physical, physical association | 19914168, 21685363, (Europe PMC) | 0.54 | BioGRID, IntAct |
| YY1 | Reconstituted Complex | physical | 12808092, (Europe PMC) | NA | BioGRID |
| ZCCHC12 | Affinity Capture-Western, Reconstituted Complex | physical | 18160706, 19416967, (Europe PMC) | NA | BioGRID |
| ZDHHC3 | Two-hybrid | physical | 15231748, (Europe PMC) | NA | BioGRID |
| ZDHHC3 | two hybrid | physical association | 15231748, (Europe PMC) | 0.37 | IntAct, MINT |
| ZEB1 | Affinity Capture-Western | physical | 12743038, (Europe PMC) | NA | BioGRID |
| ZEB2 | Affinity Capture-Western, Two-hybrid, two hybrid | physical, physical association | 15231748, 22365546, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF251 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF423 | Affinity Capture-Western | physical | 10660046, 14630787, (Europe PMC) | NA | BioGRID |
| ZNF510 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF512B | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZNF521 | Affinity Capture-Western | physical | 14630787, (Europe PMC) | NA | BioGRID |
| ZNF76 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |
| ZSCAN4 | Two-hybrid, two hybrid | physical, physical association | 15231748, (Europe PMC) | 0.37 | BioGRID, IntAct, MINT |