Top
VCP
Localization (UniProt annotation) Cytoplasm, cytosol Endoplasmic reticulum NucleusCytoplasm, Stress granule Note=Present in the neuronal hyaline inclusion bodies specificallyfound in motor neurons from amyotrophic lateral sclerosis patients(PubMed:15456787) Present in the Lewy bodies specifically foundin neurons from Parkinson disease patients (PubMed:15456787)Recruited to the cytoplasmic surface of the endoplasmic reticulumvia interaction with AMFR/gp78 (PubMed:16168377) Following DNAdouble-strand breaks, recruited to the sites of damage(PubMed:22120668) Recruited to stalled replication forks viainteraction with SPRTN (PubMed:23042605) Recruited to damagedlysosomes decorated with K48-linked ubiquitin chains(PubMed:27753622) Colocalizes with TIA1, ZFAND1 and G3BP1 incytoplasmic stress granules (SGs) in response to arsenite-inducedstress treatment (PubMed:29804830) Function (UniProt annotation) Necessary for the fragmentation of Golgi stacks duringmitosis and for their reassembly after mitosis Involved in theformation of the transitional endoplasmic reticulum (tER) Thetransfer of membranes from the endoplasmic reticulum to the Golgiapparatus occurs via 50-70 nm transition vesicles which derivefrom part-rough, part-smooth transitional elements of theendoplasmic reticulum (tER) Vesicle budding from the tER is anATP-dependent process The ternary complex containing UFD1, VCPand NPLOC4 binds ubiquitinated proteins and is necessary for theexport of misfolded proteins from the ER to the cytoplasm, wherethey are degraded by the proteasome The NPLOC4-UFD1-VCP complexregulates spindle disassembly at the end of mitosis and isnecessary for the formation of a closed nuclear envelopeRegulates E3 ubiquitin-protein ligase activity of RNF19AComponent of the VCP/p97-AMFR/gp78 complex that participates inthe final step of the sterol-mediated ubiquitination andendoplasmic reticulum-associated degradation (ERAD) of HMGCRInvolved in endoplasmic reticulum stress-induced pre-emptivequality control, a mechanism that selectively attenuates thetranslocation of newly synthesized proteins into the endoplasmicreticulum and reroutes them to the cytosol for proteasomaldegradation (PubMed:26565908) Plays a role in the regulation ofstress granules (SGs) clearance process upon arsenite-inducedresponse (PubMed:29804830) Also involved in DNA damage response:recruited to double-strand breaks (DSBs) sites in a RNF8- andRNF168-dependent manner and promotes the recruitment of TP53BP1 atDNA damage sites (PubMed:22020440, PubMed:22120668) Recruited tostalled replication forks by SPRTN: may act by mediatingextraction of DNA polymerase eta (POLH) to prevent excessivetranslesion DNA synthesis and limit the incidence of mutationsinduced by DNA damage (PubMed:23042607, PubMed:23042605) Requiredfor cytoplasmic retrotranslocation of stressed/damagedmitochondrial outer-membrane proteins and their subsequentproteasomal degradation (PubMed:16186510, PubMed:21118995)Essential for the maturation of ubiquitin-containingautophagosomes and the clearance of ubiquitinated protein byautophagy (PubMed:20104022, PubMed:27753622) Acts as a negativeregulator of type I interferon production by interacting withDDX58/RIG-I: interaction takes place when DDX58/RIG-I isubiquitinated via 'Lys-63'-linked ubiquitin on its CARD domains,leading to recruit RNF125 and promote ubiquitination anddegradation of DDX58/RIG-I (PubMed:26471729) May play a role inthe ubiquitin-dependent sorting of membrane proteins to lysosomeswhere they undergo degradation (PubMed:21822278) May moreparticularly play a role in caveolins sorting in cells(PubMed:21822278, PubMed:23335559) By controlling the steady-state expression of the IGF1R receptor, indirectly regulates theinsulin-like growth factor receptor signaling pathway(PubMed:26692333) Catalytic Activity (UniProt annotation) ATP + H(2)O = ADP + phosphate Protein Sequence MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDE
KIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRA
VEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRG
ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEV
ERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVA
NETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIG
GLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR
EIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLD
QLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAM
EVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDN
DDDLYG
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
VCP is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa04141 Protein processing in endoplasmic reticulum The endoplasmic reticulum (ER) is a subcellular organelle where proteins are folded with the help of lumenal chaperones. Newly synthesized peptides enter the ER via the sec61 pore and are glycosylated. Correctly folded proteins are packaged into transport vesicles that shuttle them to the Golgi complex. Misfolded proteins are retained within the ER lumen in complex with molecular chaperones. Proteins that are terminally misfolded bind to BiP and are directed toward degradation through the proteasome in a process called ER-associated degradation (ERAD). Accumulation of misfolded proteins in the ER causes ER stress and activates a signaling pathway called the unfolded protein response (UPR). In certain severe situations, however, the protective mechanisms activated by the UPR are not sufficient to restore normal ER function and cells die by apoptosis. hsa05134 Legionellosis Legionellosis is a potentially fatal infectious disease caused by the bacterium Legionella pneumophila and other legionella species. Two distinct clinical and epidemiological syndromes are associated with Legionella species: Legionnaires' disease is the more severe form of the infection, which may involve pneumonia, and Pontiac fever is a milder respiratory illness.The pathogenesis of L. pneumophila is derived from its growth within lung macrophages. One of the L. pneumophila's type IV secretion systems, the Dot/Icm secretion system, is of critical importance for its ability to replicate and to cause disease. The Dot/Icm substrates modulate multiple host cell processes and in particular, redirect trafficking of the L. pneumophila phagosome and mediate its conversion into an ER-derived organelle competent for intracellular bacterial replication. L. pneumophila also manipulates host cell death and survival pathways in a way that allows continued intracellular replication.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-110320 Translesion Synthesis by POLH. DNA polymerase eta (POLH) consists of 713 amino acids and can bypass thymidine-thymidine dimers, correctly adding two dAMPs opposite to the lesion. Mutations in the POLH gene result in the loss of this bypass activity and account for the XP variant phenotype (XPV) in human xeroderma pigmentosum disorder patients. POLH can carry out TLS past various UV and chemically induced lesions via two steps: (a) preferential incorporation of correct bases opposite to the lesion (b) conditional elongation only at the sites where such correct bases are inserted (Masutani et al. 1999, Masutani et al. 2000) R-HSA-3371511 HSF1 activation. Heat shock factor 1 (HSF1) is a transcription factor that activates gene expression in response to a variety of stresses, including heat shock, oxidative stress, as well as inflammation and infection (Shamovsky I and Nudler E 2008; Akerfelt et al. 2010; Bjork and Sistonen 2010; Anckar and Sistonen 2011).<p>HSF1 is constitutively present in the cell. In the absence of stress HSF1 is found in both the cytoplasm and the nucleus as an inactive monomer (Sarge KD et al. 1993; Mercier PA et al. 1999; Vujanac M et al. 2005). A physical or chemical proteotoxic stress rapidly induces HSF1 activation, which occurs through a multi?step process, involving HSF1 monomer-to-homotrimer transition, nuclear accumulation, and binding to a promoter element, called the heat shock element (HSE), which leads to the increase in the stress-inducible gene expression (Sarge KD et al. 1993; Baler R et al. 1998; Sonna LA et al. 2002; Shamovsky I and Nudler E 2008; Sakurai H and Enoki Y 2010; Herbomel G et al. 2013). Depending on the type of stress stimulus, the multiple events associated with HSF1 activation might be affected differently (Holmberg CI et al 2000; Bjork and Sistonen 2010) R-HSA-382556 ABC-family proteins mediated transport. The ATP-binding cassette (ABC) superfamily of active transporters involves a large number of functionally diverse transmembrane proteins. They transport a variety of compounds through membranes against steep concentration gradients at the cost of ATP hydrolysis. These substrates include amino acids, lipids, inorganic ions, peptides, saccharides, peptides for antigen presentation, metals, drugs, and proteins. The ABC transporters not only move a variety of substrates into and out of the cell, but are also involved in intracellular compartmental transport. Energy derived from the hydrolysis of ATP is used to transport the substrate across the membrane against a concentration gradient. Human genome contains 48 ABC genes; 16 of these have a known function and 14 are associated with a defined human disease (Dean et al. 2001, Borst and Elferink 2002, Rees et al. 2009) R-HSA-532668 N-glycan trimming in the ER and Calnexin/Calreticulin cycle. After being synthesized in the ER membrane the 14-sugars lipid-linked oligosaccharide is co-translationally transferred to an unfolded protein, as described in the previous steps. After this point the N-glycan is progressively trimmed of the three glucoses and some of the mannoses before the protein is transported to the cis-Golgi. The role of these trimming reactions is that the N-glycan attached to an unfolded glycoprotein in the ER assume the role of 'tags' that direct the interactions of the glycoprotein with different elements that mediate its folding. The removal of the two outer glucoses leads to an N-glycan with only one glucose, which is a signal for the binding of either one of two chaperone proteins, calnexin (CNX) and calreticulin (CRT). These chaperones provide an environment where the protein can fold more easily. The interaction with these proteins is not transient and is terminated by the trimming of the last remaining glucose, after which the glycoprotein is released from CNX or CRT and directed to the ER Quality Control compartment (ERQC) if it still has folding defects, or transported to the Golgi if the folding is correct. The involvement of N-glycans in the folding quality control of proteins in the ER explains why this form of glycosylation is so important, and why defects in the enzymes involved in these reactions are frequently associated with congenital diseases. However, there are many unknown points in this process, as it is known that even proteins without N-glycosylation sites can be folded properly (Caramelo JJ and Parodi AJ, 2008) R-HSA-5358346 Hedgehog ligand biogenesis. Mammalian genomes encode three Hedgehog ligands, Sonic Hedgehog (SHH), Indian Hedgehog (IHH) and Desert Hedgehog (DHH). These secreted morphogens can remain associated with lipid rafts on the surface of the secreting cell and affect developmental processes in adjacent cells. Alternatively, they can be released by proteolysis or packaging into vesicles or lipoprotein particles and dispersed to act on distant cells. SHH activity is required for organization of the limb bud, notochord and neural plate, IHH regulates bone and cartilage development and is partially redundant with SHH, and DHH contributes to germ cell development in the testis and formation of the peripheral nerve sheath (reviewed in Pan et al, 2013). Despite divergent biological roles, all Hh ligands are subject to proteolytic processing and lipid modification during transit to the surface of the secreting cell (reviewed in Gallet, 2011). Precursor Hh undergoes autoproteolytic cleavage mediated by the C-terminal region to yield an amino-terminal peptide Hh-Np (also referred to as Hh-N) (Chen et al, 2011). No other well defined role for the C-terminal region of Hh has been identified, and the secreted Hh-Np is responsible for all Hh signaling activity. Hh-Np is modified with cholesterol and palmitic acid during transit through the secretory system, and both modifications contribute to the activity of the ligand (Porter et al, 1996; Pepinsky et al, 1998; Chamoun et al, 2001). At the cell surface, Hh-Np remains associated with the secreting cell membrane by virtue of its lipid modifications, which promote clustering of Hh-Np into lipid rafts (Callejo et al, 2006; Peters et al, 2004). Long range dispersal of Hh-Np depends on the untethering of the ligand from the membrane through a variety of mechanisms. These include release of monomers through the combined activity of the transmembrane protein Dispatched (DISP2) and the secreted protein SCUBE2, assembly into soluble multimers or apolipoprotein particles or release on the surface of exovesicles (Vyas et al, 2008; Tukachinsky et al, 2012; Chen 2004; Zeng et al, 2001; reviewed in Briscoe and Therond, 2013) R-HSA-5362768 Hh mutants that don't undergo autocatalytic processing are degraded by ERAD. Hh signaling is required for a number of developmental processes, and mutations that disrupt the normal processing and biogenesis of Hh ligand can result in neonatal abnormalities. SHH is one of a number of genes that have been associated with the congenital disorder holoprosencephaly, which causes abnormalities in brain and craniofacial development (Roessler et al, 2009; reviewed in Roessler and Muenke, 2011). SHH variants associated with the condition affect the autocatalytic processing of the precursor and dramatically impair the production of the secreted active Hh-Np, abrogating signaling (reviewed in Pan et al, 2013) R-HSA-5678895 Defective CFTR causes cystic fibrosis. Cystic fibrosis transmembrane conductance regulator (CFTR) is a low conductance chloride-selective channel that mediates the transport of chloride ions in human airway epithelial cells. Chloride ions plays a key role in maintaining homoeostasis of epithelial secretions in the lungs. Defects in CFTR can cause cystic fibrosis (CF; MIM:602421), a common generalised disorder in Caucasians affecting the exocrine glands. CF results in an ionic imbalance that impairs clearance of secretions, not only in the lung, but also in the pancreas, gastrointestinal tract and liver. Wide-ranging manifestations of the disease include chronic lung disease, exocrine pancreatic insufficiency, blockage of the terminal ileum, male infertility and salty sweat. The median survival of CF patients in North America and Western Europe is around 40 years (Davis 2006, Radlovic 2012) R-HSA-5689877 Josephin domain DUBs. The Josephin domain is present in four human DUBs: Ataxin-3 (ATXN3), ATXN3L, Josephin-1 (JOSD1) and JOSD2. All have been shown to possess DUB activity (Tzveltkov & Breuer 2007, Weeks et al. 2011). Josephin domain DUBs may specialize in distinguishing between polyubiquitin chains of different lengths (Eletr & Wilkinson 2014) R-HSA-5689896 Ovarian tumor domain proteases. Humans have 16 Overian tumour domain (OTU) family DUBs that can be evolutionally divided into three classes, the OTUs, the Otubains (OTUBs), and the A20-like OTUs (Komander et al. 2009). OTU family DUBs can be highly selective in the type of ubiquitin crosslinks they cleave. OTUB1 is specific for K48-linked chains, whereas OTUB2 can cleave K11, K63 and K48-linked poly-Ub (Wang et al. 2009, Edelmann et al. 2009, Mevissen et al. 2013). A20 prefers K48-linked chains, Cezanne is specific for K11-linked chains, and TRABID acts on both K29, K33 and K63-linked poly-Ub (Licchesi et al. 2011, Komander & Barford 2008, Bremm et al. 2010, Mevissen et al. 2013). The active site of the OTU domain contains an unusual loop not seen in other thiol-DUBs and can lack an obvious catalytic Asp/Asn (Komander & Barford 2009, Messick et al. 2008, Lin et al. 2008). A20 and OTUB1 have an unusual mode of activity, binding directly to E2 enzymes (Nakada et al. 2010, Wertz et al. 2004) R-HSA-6798695 Neutrophil degranulation. Neutrophils are the most abundant leukocytes (white blood cells), indispensable in defending the body against invading microorganisms. In response to infection, neutrophils leave the circulation and migrate towards the inflammatory focus. They contain several subsets of granules that are mobilized to fuse with the cell membrane or phagosomal membrane, resulting in the exocytosis or exposure of membrane proteins. Traditionally, neutrophil granule constituents are described as antimicrobial or proteolytic, but granules also introduce membrane proteins to the cell surface, changing how the neutrophil responds to its environment (Borregaard et al. 2007). Primed neutrophils actively secrete cytokines and other inflammatory mediators and can present antigens via MHC II, stimulating T-cells (Wright et al. 2010).Granules form during neutrophil differentiation. Granule subtypes can be distinguished by their content but overlap in structure and composition. The differences are believed to be a consequence of changing protein expression and differential timing of granule formation during the terminal processes of neutrophil differentiation, rather than sorting (Le Cabec et al. 1996). The classical granule subsets are Azurophil or primary granules (AG), secondary granules (SG) and gelatinase granules (GG). Neutrophils also contain exocytosable storage cell organelles, storage vesicles (SV), formed by endocytosis they contain many cell-surface markers and extracellular, plasma proteins (Borregaard et al. 1992). Ficolin-1-rich granules (FG) are like GGs highly exocytosable but gelatinase-poor (Rorvig et al. 2009) R-HSA-8866654 E3 ubiquitin ligases ubiquitinate target proteins. E3 ubiquitin ligases catalyze the transfer of an ubiquitin from an E2-ubiquitin conjugate to a target protein. Generally, ubiquitin is transferred via formation of an amide bond to a particular lysine residue of the target protein, but ubiquitylation of cysteine, serine and threonine residues in a few targeted proteins has also been demonstrated (reviewed in McDowell and Philpott 2013, Berndsen and Wolberger 2014). Based on protein homologies, families of E3 ubiquitin ligases have been identified that include RING-type ligases (reviewed in Deshaies et al. 2009, Metzger et al. 2012, Metzger et al. 2014), HECT-type ligases (reviewed in Rotin et al. 2009, Metzger et al. 2012), and RBR-type ligases (reviewed in Dove et al. 2016). A subset of the RING-type ligases participate in CULLIN-RING ligase complexes (CRLs which include SCF complexes, reviewed in Lee and Zhou 2007, Genschik et al. 2013, Skaar et al. 2013, Lee et al. 2014).Some E3-E2 combinations catalyze mono-ubiquitination of the target protein (reviewed in Nakagawa and Nakayama 2015). Other E3-E2 combinations catalyze conjugation of further ubiquitin monomers to the initial ubiquitin, forming polyubiquitin chains. (It may also be possible for some E3-E2 combinations to preassemble polyubiquitin and transfer it as a unit to the target protein.) Ubiquitin contains several lysine (K) residues and a free alpha amino group to which further ubiquitin can be conjugated. Thus different types of polyubiquitin are possible: K11 linked polyubiquitin is observed in endoplasmic reticulum-associated degradation (ERAD), K29 linked polyubiquitin is observed in lysosomal degradation, K48 linked polyubiquitin directs target proteins to the proteasome for degradation, whereas K63 linked polyubiquitin generally acts as a scaffold to recruit other proteins in several cellular processes, notably DNA repair (reviewed in Komander et al. 2009) R-HSA-8876725 Protein methylation. Methylation of lysine (Lys) and arginine (Arg) residues on non-histone proteins is a prevalent post-translational modification and important regulator of cellular signal transduction pathways including MAPK, WNT, BMP, Hippo and JAK–STAT. Crosstalk between methylation and other types of post-translational modifications and between histone and non-histone protein methylation is frequent, affecting cellular functions such as chromatin remodelling, gene transcription, protein synthesis, signal transduction and DNA repair (Biggar & Li 2015)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCC3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ACACA Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ACTB Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID ACTN1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ACTN4 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ADD1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ADRB2 Affinity Capture-MS physical 23798571 , (Europe PMC )NA BioGRID AKT1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity physical 16027165 , 16551632 , 23383273 , (Europe PMC )NA BioGRID ALDH18A1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ALS2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID AMFR Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, filter binding, fluorescence microscopy, pull down association, direct interaction, physical, physical association 15331598 , 16186510 , 16275660 , 16407162 , 16987818 , 17311810 , 17681147 , 17872946 , 18835813 , 19828134 , 20126661 , 21343306 , 21636303 , 21914798 , 22119785 , 22328510 , 23333620 , 23383273 , 24100225 , 26424800 , 26712280 , (Europe PMC )0.83 BioGRID, IntAct ANAPC7 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ANKHD1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ANKLE2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID ANKRD13A Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 26797118 , (Europe PMC )NA BioGRID ANKRD13B Affinity Capture-MS, Affinity Capture-Western physical 26797118 , (Europe PMC )NA BioGRID ANKRD13D Affinity Capture-MS, Affinity Capture-Western physical 26797118 , (Europe PMC )NA BioGRID ANKZF1 Affinity Capture-Western, Protein-peptide, Two-hybrid physical 21896481 , 21914798 , (Europe PMC )NA BioGRID ANXA2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ANXA5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ANXA7 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID AP1B1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID AP2A2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID APOA1 Affinity Capture-Western physical 19164805 , (Europe PMC )NA BioGRID APOB Affinity Capture-Western physical 18550891 , 19164805 , 28183703 , (Europe PMC )NA BioGRID APPL1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID AR Affinity Capture-Western, Reconstituted Complex physical 23652004 , (Europe PMC )NA BioGRID ARF6 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARFGAP2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARFGEF2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARHGAP17 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARHGEF2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARIH1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARIH2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARPC2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARRB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 17620599 , (Europe PMC )0.35 BioGRID, IntAct ASPSCR1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 18775313 , 21900206 , 22350894 , 23383273 , 23443559 , 25078495 , 25416956 , 26389662 , 26496610 , 28514442 , (Europe PMC )0.81 BioGRID, IntAct, MINT ATAD3A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATAD3B Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATG5 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID ATG9A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ATXN1 Affinity Capture-Western, Reconstituted Complex physical 23652004 , (Europe PMC )NA BioGRID ATXN10 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ATXN3 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, competition binding, cosedimentation through density gradient, fluorescence microscopy, peptide array, pull down association, colocalization, direct interaction, physical, physical association 12944474 , 14749733 , 16525503 , 16822850 , 18199748 , 19175675 , 19843543 , 20414249 , 22970133 , 23383273 , 24100225 , 25231079 , 27851749 , 28180282 , 28275011 , (Europe PMC )0.40, 0.83 BioGRID, IntAct, MINT ATXN7 Affinity Capture-Western, Reconstituted Complex physical 23652004 , (Europe PMC )NA BioGRID AUP1 Affinity Capture-MS, Affinity Capture-Western physical 21857022 , (Europe PMC )NA BioGRID AVPR2 Affinity Capture-Western physical 18048502 , (Europe PMC )NA BioGRID BAD Affinity Capture-Western physical 23383273 , (Europe PMC )NA BioGRID BAG2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BAG6 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation physical 21636303 , 23383273 , 23665563 , (Europe PMC )NA BioGRID BAIAP2L1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BAX Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BCCIP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BCLAF1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BID Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BLM Synthetic Growth Defect genetic 24104479 , (Europe PMC )NA BioGRID BRAT1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BRCA1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 10855792 , 26831064 , (Europe PMC )NA BioGRID BRSK2 Affinity Capture-Western, Reconstituted Complex physical 23907667 , (Europe PMC )NA BioGRID BSG Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BTRC Affinity Capture-Western physical 24248593 , 24429874 , 26112410 , (Europe PMC )NA BioGRID BUD23 Two-hybrid physical 21988832 , (Europe PMC )NA BioGRID BZW2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CAAP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CAB39 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CACNA1C Affinity Capture-Western physical 21186355 , (Europe PMC )NA BioGRID CALR Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CALU Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CANX Affinity Capture-MS, Co-fractionation, cosedimentation through density gradient colocalization, physical 17948026 , 23383273 , 26344197 , (Europe PMC )0.35 BioGRID, IntAct, MINT CASP7 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CASP9 Affinity Capture-Western physical 23383273 , (Europe PMC )NA BioGRID CASR Affinity Capture-Western physical 16513638 , (Europe PMC )NA BioGRID CAV1 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 23335559 , 24089527 , (Europe PMC )NA BioGRID CCDC134 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CCDC8 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CCNB1 Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID CCT2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 23190606 , 23383273 , (Europe PMC )NA BioGRID CCT3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CCT4 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CCT5 Affinity Capture-MS, Co-fractionation physical 22939629 , 23383273 , (Europe PMC )NA BioGRID CCT6A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CCT7 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CCT8 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CD3D Affinity Capture-Western physical 15331598 , 17872946 , (Europe PMC )NA BioGRID CD4 Affinity Capture-Western physical 22090097 , (Europe PMC )NA BioGRID CDC25A Affinity Capture-Western physical 24429874 , (Europe PMC )NA BioGRID CDC27 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CDC37 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CDC42EP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CDC42EP4 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CDC73 Affinity Capture-MS physical 27462432 , (Europe PMC )NA BioGRID CDK1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CDK2 Affinity Capture-MS physical 21319273 , 23443559 , (Europe PMC )NA BioGRID CDK2AP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CDK4 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CDKN1A Affinity Capture-Western physical 23383273 , (Europe PMC )NA BioGRID CDKN1B Affinity Capture-Western physical 23383273 , (Europe PMC )NA BioGRID CDKN2AIP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CENPH Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CEP19 Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct CEP55 Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID CFTR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 16621797 , 16954204 , 17110338 , 17272822 , 18216283 , 19828134 , 26618866 , (Europe PMC )0.35 BioGRID, IntAct CHEK1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CHEK2 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17525332 , (Europe PMC )0.52 BioGRID, IntAct CHMP4B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CIDEC Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CIP2A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CLASP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CLGN Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CLN6 Affinity Capture-Western physical 18811591 , (Europe PMC )NA BioGRID CLTA Affinity Capture-Western physical 8413590 , (Europe PMC )NA BioGRID CLUAP1 Reconstituted Complex physical 26389662 , (Europe PMC )NA BioGRID CNOT10 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CNOT2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CNOT8 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CNOT9 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COG4 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COG5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COIL Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COMMD1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COMMD6 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COMT Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COPE Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COPS3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COPS5 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex physical 19826004 , 21145461 , (Europe PMC )NA BioGRID COPS7A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COQ8A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CRBN Affinity Capture-MS physical 26990986 , (Europe PMC )NA BioGRID CRMP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CRY2 Affinity Capture-MS physical 25756610 , (Europe PMC )NA BioGRID CSK Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CSNK2B Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CTNNA1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CTNNBL1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CTNND1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CUL1 Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 18775313 , 22466964 , 26112410 , (Europe PMC )0.35 BioGRID, IntAct CUL2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 18775313 , 21145461 , 22466964 , (Europe PMC )0.53 BioGRID, IntAct CUL3 Affinity Capture-MS, Affinity Capture-Western physical 21145461 , 22466964 , (Europe PMC )NA BioGRID CUL4A Affinity Capture-Western, anti tag coimmunoprecipitation association, physical, physical association 22466964 , (Europe PMC )0.50 BioGRID, IntAct CUL5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 23383273 , 24711643 , (Europe PMC )NA BioGRID CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID DAP3 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID DCAF11 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID DCAF7 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID DDIAS Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID DDX54 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID DERL1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Protein-peptide, Reconstituted Complex physical 16186509 , 16186510 , 16289116 , 16901789 , 17872946 , 18199748 , 21909096 , 22119785 , 27714797 , 28137758 , (Europe PMC )NA BioGRID DERL2 Affinity Capture-MS, Affinity Capture-Western physical 16186509 , 21909096 , 22119785 , 23867461 , (Europe PMC )NA BioGRID DGAT2 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 24820123 , (Europe PMC )0.40 BioGRID, IntAct, MINT DGCR6 Two-hybrid physical 24722188 , (Europe PMC )NA BioGRID DIAPH3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID DIO2 Affinity Capture-Western physical 24196352 , (Europe PMC )NA BioGRID DLD Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DNAJB11 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID DNAJB9 Affinity Capture-Western physical 18400946 , (Europe PMC )NA BioGRID DNAJC10 Affinity Capture-Western physical 18400946 , (Europe PMC )NA BioGRID DNM1L Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DNM3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID DOCK7 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID DSP Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID DSTN Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID DTNB Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct DUSP9 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID DYNC1I2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID DYNC1LI1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID EEA1 Affinity Capture-Western physical 21556036 , (Europe PMC )NA BioGRID EEF1A2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID EIF4A2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID EIF5A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ELAVL1 Affinity Capture-Western, Reconstituted Complex physical 23618873 , (Europe PMC )NA BioGRID ENTR1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID EPPK1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID ERCC6 Affinity Capture-Western physical 26826127 , (Europe PMC )NA BioGRID ERCC8 Affinity Capture-Western physical 26826127 , (Europe PMC )NA BioGRID ESPL1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ESR1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID ESS2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID EZH2 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID F7 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID FAF1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti tag coimmunoprecipitation, molecular sieving, pull down, x-ray crystallography association, direct interaction, physical, physical association 15743842 , 18775313 , 20057067 , 21645854 , 21914798 , 22102026 , 22350894 , 23293021 , 23383273 , 24885147 , 26389662 , 26842564 , (Europe PMC )0.50, 0.62 BioGRID, IntAct FAF2 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 18711132 , 18775313 , 18835813 , 22119785 , 22350894 , 22466964 , 23665563 , 25078495 , 26389662 , (Europe PMC )0.56 BioGRID, IntAct FAM104A Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 23443559 , 25416956 , 26496610 , 28514442 , (Europe PMC )0.49 BioGRID, IntAct FAM189B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FANCI Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID FBF1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID FBXL2 Affinity Capture-Western physical 28614300 , (Europe PMC )NA BioGRID FBXO2 Affinity Capture-Western physical 15723043 , (Europe PMC )NA BioGRID FBXO6 Affinity Capture-Western physical 15723043 , (Europe PMC )NA BioGRID FBXW11 Affinity Capture-Western physical 24248593 , (Europe PMC )NA BioGRID FCHSD2 Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, two hybrid physical, physical association 18654987 , (Europe PMC )0.51 BioGRID, IntAct FERMT2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID FHOD1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID FKBP15 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID FLNB Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID FN1 Affinity Capture-MS physical 19738201 , (Europe PMC )NA BioGRID FUS Affinity Capture-MS, Affinity Capture-Western physical 25192599 , (Europe PMC )NA BioGRID G3BP1 Affinity Capture-MS physical 26777405 , (Europe PMC )NA BioGRID G3BP2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GABRA1 Affinity Capture-Western physical 26945068 , (Europe PMC )NA BioGRID GBF1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GET4 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GGA1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GGA2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GIGYF2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID GLB1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID GOLPH3L Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.57 BioGRID, IntAct GRIN2D Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID GRWD1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID GTF3C1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GTF3C3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GTF3C5 Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID GZMK Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity physical 20876349 , (Europe PMC )NA BioGRID H2AFJ Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID H2AFV Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID HAUS1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HDAC5 Affinity Capture-MS physical 21081666 , (Europe PMC )NA BioGRID HDLBP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HEATR1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HELLS Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HERPUD1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex physical 16289116 , (Europe PMC )NA BioGRID HEY1 Affinity Capture-MS physical 27129302 , (Europe PMC )NA BioGRID HIF1A Affinity Capture-Western physical 18775313 , (Europe PMC )NA BioGRID HIP1R Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HLA-A Affinity Capture-Western physical 20702414 , (Europe PMC )NA BioGRID HLA-B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HLA-DRB1 Affinity Capture-Western physical 18022694 , (Europe PMC )NA BioGRID HMGCR Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 21343306 , (Europe PMC )0.35 BioGRID, IntAct HNF1A Affinity Capture-MS physical 18160415 , (Europe PMC )NA BioGRID HNRNPA1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HNRNPH1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID HNRNPH2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HNRNPH3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HNRNPK Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HOOK1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HS1BP3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HSBP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HSP90AA1 Affinity Capture-MS, Affinity Capture-Western physical 16621797 , 23383273 , (Europe PMC )NA BioGRID HSP90AB1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HSP90B1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSP90B2P Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HSPA1A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HSPA4 Affinity Capture-MS, Affinity Capture-Western physical 16621797 , 23383273 , (Europe PMC )NA BioGRID HSPA5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation physical 16621797 , 22939629 , 23383273 , (Europe PMC )NA BioGRID HSPB1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HSPD1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID HSPE1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HTRA2 Affinity Capture-MS physical 26389662 , (Europe PMC )NA BioGRID HTT Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 20126661 , 23383273 , 23652004 , (Europe PMC )NA BioGRID HUWE1 Affinity Capture-MS physical 23383273 , 25147182 , (Europe PMC )NA BioGRID ICK Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID IFT74 Affinity Capture-MS physical 26389662 , (Europe PMC )NA BioGRID IFT88 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26389662 , 27173435 , (Europe PMC )0.35 BioGRID, IntAct IKBKE Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct INF2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID INSIG1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 16168377 , 18835813 , 19815544 , (Europe PMC )NA BioGRID INSIG2 Affinity Capture-MS, Reconstituted Complex physical 19815544 , (Europe PMC )NA BioGRID IPO4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID IQCB1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID IQGAP1 Affinity Capture-MS, Affinity Capture-Western, Co-localization physical 23443559 , 28970065 , (Europe PMC )NA BioGRID IQGAP2 Affinity Capture-Western physical 28970065 , (Europe PMC )NA BioGRID IQGAP3 Affinity Capture-Western physical 28970065 , (Europe PMC )NA BioGRID IRS4 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID ISG15 Affinity Capture-MS physical 16009940 , (Europe PMC )NA BioGRID ISYNA1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID ITGB1 Affinity Capture-Western physical 15723043 , (Europe PMC )NA BioGRID ITGB4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ITPR1 Affinity Capture-Western physical 19240031 , (Europe PMC )NA BioGRID ITPR3 Affinity Capture-Western physical 28614300 , (Europe PMC )NA BioGRID KCMF1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID KDM3B Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID KDSR Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KIF1BP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID KIF20A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct L3MBTL1 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 22120668 , 23652004 , (Europe PMC )0.40 BioGRID, IntAct LMAN1 Affinity Capture-MS physical 22337587 , (Europe PMC )NA BioGRID LMNA Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID LMNB2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID LNPK Affinity Capture-MS physical 27716508 , (Europe PMC )NA BioGRID LNX1 Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct LRBA Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID LRIG1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID LYAR Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MAP1LC3A Co-localization physical 21909394 , (Europe PMC )NA BioGRID MAP2K1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MAP7D3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MAPK1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MAPK13 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MAPK3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MAPK8IP2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MARK2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MCC Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MCM2 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MDM2 Affinity Capture-MS physical 23383273 , 24147044 , (Europe PMC )NA BioGRID MDN1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MRPS18B Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID MRPS23 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID MSH4 Affinity Capture-Western physical 23964080 , (Europe PMC )NA BioGRID MTOR Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MUS81 Synthetic Growth Defect genetic 24104479 , (Europe PMC )NA BioGRID NACA2 Co-fractionation physical 22939629 , 26344197 , (Europe PMC )NA BioGRID NAPA Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NASP Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID NBEA Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NCAPH Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23383273 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct NCDN Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NCOA1 Affinity Capture-MS physical 16051665 , (Europe PMC )NA BioGRID NDRG1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17220478 , (Europe PMC )0.40 BioGRID, IntAct NEK2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NEPRO Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NF1 Affinity Capture-Western, Reconstituted Complex physical 22105171 , (Europe PMC )NA BioGRID NFKB1 Affinity Capture-Western physical 26112410 , (Europe PMC )NA BioGRID NFKB2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NFKBIA Affinity Capture-Western, Reconstituted Complex, tandem affinity purification physical, physical association 10930447 , 14743216 , 23383273 , 23393163 , 24248593 , 26463447 , 9452483 , (Europe PMC )0.40 BioGRID, IntAct NGLY1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical 15362974 , 16807242 , 20414249 , 22119785 , (Europe PMC )0.35 BioGRID, IntAct, MINT NIPSNAP1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID NIPSNAP2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID NMD3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NME2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NOS2 Affinity Capture-MS physical 23438482 , (Europe PMC )NA BioGRID NPLOC4 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, molecular sieving, pull down association, physical, physical association 15371428 , 16234241 , 17872946 , 18586029 , 18775313 , 20414249 , 21645854 , 23293021 , 23333620 , 26389662 , 26549226 , 27226613 , 27913212 , (Europe PMC )0.77 BioGRID, IntAct, MINT NPM1 Affinity Capture-MS physical 23402259 , (Europe PMC )NA BioGRID NSF Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NSFL1C Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, filter binding, isothermal titration calorimetry, two hybrid association, direct interaction, physical, physical association 12473691 , 12810701 , 16234241 , 16275660 , 18775313 , 20414249 , 21645854 , 21900206 , 21949850 , 22350894 , 22466964 , 23443559 , 25078495 , 25416956 , 25775548 , 26344197 , 26389662 , 26496610 , 26712280 , 27226613 , 27785701 , 27913212 , 28514442 , (Europe PMC )0.92 BioGRID, IntAct, MINT NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NUB1 Affinity Capture-Western, Reconstituted Complex physical 24019527 , 24100225 , (Europe PMC )NA BioGRID NUMA1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NUP107 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NUP205 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NUP54 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID NUP58 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NUP62 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID OS9 Affinity Capture-MS physical 23097496 , (Europe PMC )NA BioGRID OTULIN Co-fractionation, Protein-peptide physical 24726323 , (Europe PMC )NA BioGRID P4HB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PACRG Affinity Capture-Western physical 14532270 , (Europe PMC )NA BioGRID PDCD10 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PDCD4 Affinity Capture-MS, Affinity Capture-Western physical 23383273 , (Europe PMC )NA BioGRID PDCD6 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PDK3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PDXDC1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PEX19 Affinity Capture-Western physical 23457492 , (Europe PMC )NA BioGRID PHB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PHKG2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID PIK3C2B Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PIK3R2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PIK3R3 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PKM Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PKN2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PLAA Affinity Capture-Western, Co-crystal Structure, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 19887378 , 25416956 , (Europe PMC )0.49 BioGRID, IntAct PLEC Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PLK1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PLPP3 Affinity Capture-Western physical 26549226 , (Europe PMC )NA BioGRID PNO1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID POLR2A Affinity Capture-Western physical 28036256 , (Europe PMC )NA BioGRID POLR2B Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID POLR3C Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PPFIBP1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID PPM1B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , 23443559 , (Europe PMC )0.40 BioGRID, IntAct PPP1CC Affinity Capture-MS, Affinity Capture-Western physical 17683050 , (Europe PMC )NA BioGRID PPP1R18 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP2CA Affinity Capture-Western physical 20100830 , 23108140 , (Europe PMC )NA BioGRID PPP2CB Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PPP2R1A Affinity Capture-Western physical 20100830 , 23108140 , (Europe PMC )NA BioGRID PPP3CA Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID PPP6C Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PPT1 Affinity Capture-MS, Affinity Capture-Western physical 25865307 , (Europe PMC )NA BioGRID PRKAA1 Affinity Capture-MS physical 16306228 , (Europe PMC )NA BioGRID PRKAG1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PRKAR2A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PRKCD Reconstituted Complex physical 20395553 , (Europe PMC )NA BioGRID PRKN Affinity Capture-MS, Affinity Capture-Western physical 14532270 , 23503661 , 28514442 , (Europe PMC )NA BioGRID PRMT3 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PRMT5 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PRPF19 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID PRPF31 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID PRPF4 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID PSMA1 Affinity Capture-Western, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 23393163 , 25416956 , (Europe PMC )0.49 BioGRID, IntAct PSMA2 Affinity Capture-MS, Co-fractionation physical 19193609 , 22939629 , (Europe PMC )NA BioGRID PSMA3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PSMA4 Co-fractionation physical 22939629 , 26344197 , (Europe PMC )NA BioGRID PSMA6 Affinity Capture-Western physical 19822669 , (Europe PMC )NA BioGRID PSMA7 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PSMC1 Affinity Capture-Western physical 9452483 , (Europe PMC )NA BioGRID PSMC4 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID PSMC5 Affinity Capture-Western physical 26337389 , (Europe PMC )NA BioGRID PSMD4 Affinity Capture-Western physical 15362974 , 24196352 , (Europe PMC )NA BioGRID PTCRA Affinity Capture-Western physical 22795130 , (Europe PMC )NA BioGRID PTGES3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PTGS2 Affinity Capture-Western physical 24089527 , (Europe PMC )NA BioGRID PTPN22 Affinity Capture-MS, pull down association, physical 16461343 , (Europe PMC )0.35 BioGRID, IntAct PTPN23 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PTPN9 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PTPRO Affinity Capture-MS, Affinity Capture-Western physical 23533167 , (Europe PMC )NA BioGRID RAB10 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RAB11B Affinity Capture-MS, Co-fractionation physical 23383273 , 26344197 , (Europe PMC )NA BioGRID RAB14 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RAB3GAP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RAB3GAP2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RAB7A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RABGAP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RAD23A Affinity Capture-Western physical 22970133 , (Europe PMC )NA BioGRID RAF1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RANBP2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RBBP4 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RBFOX2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RBM23 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RCN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RDX Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RELCH Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RFC3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RFC5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RHBDD1 Co-crystal Structure, Reconstituted Complex physical 27407164 , (Europe PMC )NA BioGRID RHBDL3 Affinity Capture-Western physical 22795130 , (Europe PMC )NA BioGRID RIF1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RNF103 Affinity Capture-Western physical 18675248 , (Europe PMC )NA BioGRID RNF126 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RNF19A Affinity Capture-Western, Reconstituted Complex physical 15456787 , 16513638 , (Europe PMC )NA BioGRID RNF2 Affinity Capture-MS physical 23383273 , 24457600 , (Europe PMC )NA BioGRID RNF31 Affinity Capture-MS, Co-crystal Structure, Protein-peptide, Reconstituted Complex physical 24726323 , 24726327 , (Europe PMC )NA BioGRID RNF7 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RNF8 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID RPA2 Affinity Capture-Western physical 28575658 , (Europe PMC )NA BioGRID RPL13 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPL18A Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPL22 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPL23 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPL24 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPL30 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPL6 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RPL9 Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct RPN1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RPN2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RPS11 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPS13 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RPS25 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPS3 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPS3A Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPS4X Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPS6 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPS6KA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RPS8 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPS9 Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID RRBP1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RRP12 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RSU1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RUVBL2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID SAP18 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SCD Affinity Capture-Western, Co-fractionation physical 16723740 , 26344197 , (Europe PMC )NA BioGRID SCFD1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SEC16A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SEC22B Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SELENOS Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 15215856 , 16289116 , 17872946 , 18199748 , 21832065 , 22119785 , 24424410 , 24700463 , 25008318 , 26549226 , (Europe PMC )NA BioGRID SEM1 Affinity Capture-MS, Affinity Capture-Western physical 24811749 , (Europe PMC )NA BioGRID SENP3 Affinity Capture-MS physical 26511642 , (Europe PMC )NA BioGRID SERPINA1 Affinity Capture-Western physical 21135095 , (Europe PMC )NA BioGRID SESN2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SFTPC Affinity Capture-Western physical 19815549 , (Europe PMC )NA BioGRID SGK1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct SH2D1A Affinity Capture-Western physical 19570996 , (Europe PMC )NA BioGRID SH2D2A Affinity Capture-MS, Affinity Capture-Western, Far Western, pull down association, physical 15752563 , (Europe PMC )0.35 BioGRID, IntAct, MINT SIK2 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-fractionation, Reconstituted Complex, tandem affinity purification association, physical 16306228 , 24129571 , 24841198 , (Europe PMC )0.35 BioGRID, IntAct SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SKP1 Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID SLC17A2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SLC25A3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SLC3A2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SLIRP Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID SLX4 Affinity Capture-MS physical 22902628 , (Europe PMC )NA BioGRID SMARCA5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SMARCC1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SMURF1 Affinity Capture-MS physical 23184937 , (Europe PMC )NA BioGRID SNX3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SON Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SPAST Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SPC24 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SPRTN Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex physical 22902628 , 23042605 , 23042607 , (Europe PMC )NA BioGRID SPTAN1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID SRRM2 Affinity Capture-MS physical 16159877 , (Europe PMC )NA BioGRID SRSF11 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SRSF3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ST13 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID STAG2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID STAM2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID STAT1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID STIP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STMN1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID STUB1 Affinity Capture-Western, Reconstituted Complex physical 16621797 , 24100225 , (Europe PMC )NA BioGRID SUMO1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SUMO2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SUPT16H Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SUPT6H Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID SUZ12 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID SVIP Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Co-localization, Protein-peptide, Reconstituted Complex physical 17872946 , 21909394 , 21914798 , 24100225 , (Europe PMC )NA BioGRID SYF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYMPK Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID SYVN1 Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 16186510 , 16289116 , 16822850 , 17872946 , 20414249 , 24100225 , 26424800 , 26471130 , (Europe PMC )0.46 BioGRID, IntAct, MINT TAF6L Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TARDBP Affinity Capture-MS, Affinity Capture-Western physical 19237541 , 20020773 , (Europe PMC )NA BioGRID TAX1BP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TBC1D10B Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TBC1D9B Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TCP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TDP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TELO2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TERF2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TIMM44 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID TKT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TLE3 Affinity Capture-Western physical 28689657 , (Europe PMC )NA BioGRID TMED10 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TMEM129 Affinity Capture-Western physical 24807418 , (Europe PMC )NA BioGRID TMEM33 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TMPRSS13 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID TNKS1BP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TNPO3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TOM1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TOM1L1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TOMM34 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11913976 , (Europe PMC )NA BioGRID TOP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TP53 Affinity Capture-MS, Affinity Capture-Western physical 23383273 , 23443559 , (Europe PMC )NA BioGRID TP53BP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TP63 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 20085233 , (Europe PMC )0.35 BioGRID, IntAct TPD52L2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID TPM3P4 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TRA Affinity Capture-Western physical 21636303 , (Europe PMC )NA BioGRID TRAF6 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification physical, physical association 14743216 , 17353931 , (Europe PMC )0.59 BioGRID, IntAct TRIM13 Affinity Capture-MS, Affinity Capture-Western physical 17314412 , (Europe PMC )NA BioGRID TRIM21 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-MS physical 23383273 , 29117863 , (Europe PMC )NA BioGRID TRIP12 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TSG101 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TTC26 Affinity Capture-MS physical 26389662 , (Europe PMC )NA BioGRID TTC4 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TTK Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TTR Affinity Capture-Western physical 26565908 , (Europe PMC )NA BioGRID TUBA1C Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID TUBB Affinity Capture-MS, Co-fractionation physical 23443559 , 26344197 , (Europe PMC )NA BioGRID TUBB2B Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TUBB3 Co-fractionation, pull down association, physical 26344197 , 27291054 , (Europe PMC )0.35 BioGRID, IntAct TUBB4B Affinity Capture-MS, Co-fractionation physical 23443559 , 26344197 , (Europe PMC )NA BioGRID TUBGCP2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TXN2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TXNDC5 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID U2AF2 Affinity Capture-MS physical 26641092 , (Europe PMC )NA BioGRID UBA5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID UBB Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID UBC Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 11483959 , 16196087 , 16822850 , 17550899 , 27407164 , 28190767 , (Europe PMC )NA BioGRID UBE2J1 Affinity Capture-Western physical 20435896 , (Europe PMC )NA BioGRID UBE2M Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID UBE2S Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID UBE4B Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 14749733 , 18022694 , 19175675 , 20414249 , 21282470 , 26389662 , 27226613 , 28514442 , (Europe PMC )NA BioGRID UBL4A Affinity Capture-MS, Affinity Capture-Western physical 21636303 , 23246001 , (Europe PMC )NA BioGRID UBL7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID UBOX5 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID UBQLN1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 19822669 , 23383273 , (Europe PMC )NA BioGRID UBR4 Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID UBR5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID UBXN1 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation association, physical 15362974 , 18775313 , 21135095 , 25416956 , 26389662 , 27785701 , (Europe PMC )0.35 BioGRID, IntAct UBXN10 Affinity Capture-MS, Affinity Capture-Western physical 18775313 , 26389662 , (Europe PMC )NA BioGRID UBXN11 Affinity Capture-Western physical 18775313 , (Europe PMC )NA BioGRID UBXN2A Affinity Capture-MS, Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 18775313 , 21900206 , 23443559 , 26389662 , 28514442 , (Europe PMC )0.62 BioGRID, IntAct, MINT UBXN2B Affinity Capture-MS, Reconstituted Complex, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 18775313 , 25416956 , 25775548 , 26186194 , 26389662 , 28514442 , (Europe PMC )0.49 BioGRID, IntAct UBXN4 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation association, physical, physical association 16968747 , 18775313 , 19822669 , 25078495 , 26389662 , (Europe PMC )0.50 BioGRID, IntAct UBXN6 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 16807242 , 18775313 , 19174149 , 19275885 , 21896481 , 21914798 , 22337587 , 22350894 , 23383273 , 25078495 , 26186194 , 26389662 , 26475856 , 27913212 , 28514442 , (Europe PMC )NA BioGRID UBXN7 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Reconstituted Complex, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach association, physical, physical association 18775313 , 22466964 , 26389662 , 28274878 , (Europe PMC )0.75 BioGRID, IntAct UBXN8 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation association, physical 18775313 , 21949850 , 25078495 , 26389662 , (Europe PMC )0.35 BioGRID, IntAct UFD1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Reconstituted Complex physical 15371428 , 16234241 , 16822850 , 17872946 , 18199748 , 18775313 , 19275885 , 20414249 , 23333620 , 23443559 , 24248593 , 26389662 , 26549226 , 26712280 , 27226613 , 27913212 , (Europe PMC )NA BioGRID ULK3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID USP10 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID USP13 Affinity Capture-Western, Reconstituted Complex physical 24424410 , (Europe PMC )NA BioGRID VAPA Affinity Capture-Western physical 24885147 , (Europe PMC )NA BioGRID VAPB Affinity Capture-Western physical 24885147 , (Europe PMC )NA BioGRID VBP1 Affinity Capture-Western physical 23964080 , (Europe PMC )NA BioGRID VCAM1 Affinity Capture-MS, Affinity Capture-Western, cross-linking study association, physical 19738201 , 22623428 , 26337389 , (Europe PMC )0.35 BioGRID, IntAct VCL Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID VCP Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Reconstituted Complex, Two-hybrid, atomic force microscopy, electron tomography, ion mobility mass spectrometry of complexes, transmission electron microscopy, x-ray crystallography direct interaction, physical 10350210 , 12807884 , 16621797 , 17525332 , 18044963 , 20512113 , 22270372 , 23383273 , 24055316 , 25416956 , 26712278 , 26822609 , 26849035 , (Europe PMC )0.85 BioGRID, IntAct, MINT VCPIP1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 19615732 , 21811234 , 23500464 , 24163436 , 26389662 , (Europe PMC )0.40 BioGRID, IntAct VCPKMT Affinity Capture-MS, Biochemical Activity, Reconstituted Complex physical 23349634 , 28514442 , (Europe PMC )NA BioGRID VIL1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID VIM Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID VPS18 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct VPS50 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID VPS53 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID WAC Affinity Capture-Western, Reconstituted Complex physical 21811234 , (Europe PMC )NA BioGRID WAPL Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID WDR43 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID WDR82 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID WDYHV1 Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct WNK1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID WRAP73 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct WRN Affinity Capture-Western, pull down physical, physical association 12937274 , 15037256 , (Europe PMC )0.40 BioGRID, IntAct WRNIP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID YAP1 Affinity Capture-MS physical 25796446 , (Europe PMC )NA BioGRID YOD1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 19818707 , 24417208 , 28244869 , (Europe PMC )0.49 BioGRID, IntAct YWHAB Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID YWHAE Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID YWHAG Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID YWHAH Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID YWHAQ Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID YWHAZ Affinity Capture-MS, Two-hybrid, pull down, two hybrid array physical, physical association 15161933 , 21988832 , 23383273 , (Europe PMC )0.57 BioGRID, IntAct, MINT ZFAND2B Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 24160817 , 26337389 , (Europe PMC )NA BioGRID ZFR Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ZNF326 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ZNF778 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ARRB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 17620599 , (Europe PMC )0.35 BioGRID, IntAct ASPM pull down association 28436967 , (Europe PMC )0.35 IntAct ASPSCR1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 18775313 , 21900206 , 22350894 , 23383273 , 23443559 , 25078495 , 25416956 , 26389662 , 26496610 , 28514442 , (Europe PMC )0.81 BioGRID, IntAct, MINT ATXN3 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, competition binding, cosedimentation through density gradient, fluorescence microscopy, peptide array, pull down association, colocalization, direct interaction, physical, physical association 12944474 , 14749733 , 16525503 , 16822850 , 18199748 , 19175675 , 19843543 , 20414249 , 22970133 , 23383273 , 24100225 , 25231079 , 27851749 , 28180282 , 28275011 , (Europe PMC )0.40, 0.83 BioGRID, IntAct, MINT BCAR3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct BUD23 two hybrid physical association 21988832 , (Europe PMC )0.37 IntAct CANX Affinity Capture-MS, Co-fractionation, cosedimentation through density gradient colocalization, physical 17948026 , 23383273 , 26344197 , (Europe PMC )0.35 BioGRID, IntAct, MINT CD247 pull down association 24502978 , (Europe PMC )0.35 IntAct, MINT CEP19 Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct CFTR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 16621797 , 16954204 , 17110338 , 17272822 , 18216283 , 19828134 , 26618866 , (Europe PMC )0.35 BioGRID, IntAct CHEK2 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17525332 , (Europe PMC )0.52 BioGRID, IntAct CHMP4B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CRMP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CUL1 Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 18775313 , 22466964 , 26112410 , (Europe PMC )0.35 BioGRID, IntAct CUL2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 18775313 , 21145461 , 22466964 , (Europe PMC )0.53 BioGRID, IntAct CUL4A Affinity Capture-Western, anti tag coimmunoprecipitation association, physical, physical association 22466964 , (Europe PMC )0.50 BioGRID, IntAct DERL1 anti bait coimmunoprecipitation association 16901789 , (Europe PMC )0.35 IntAct DGAT2 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 24820123 , (Europe PMC )0.40 BioGRID, IntAct, MINT DLD Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DNM1L Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DTNB Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct EBI-1059081 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ECH1 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct FAF1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti tag coimmunoprecipitation, molecular sieving, pull down, x-ray crystallography association, direct interaction, physical, physical association 15743842 , 18775313 , 20057067 , 21645854 , 21914798 , 22102026 , 22350894 , 23293021 , 23383273 , 24885147 , 26389662 , 26842564 , (Europe PMC )0.50, 0.62 BioGRID, IntAct FAF2 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 18711132 , 18775313 , 18835813 , 22119785 , 22350894 , 22466964 , 23665563 , 25078495 , 26389662 , (Europe PMC )0.56 BioGRID, IntAct FAM104A Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 23443559 , 25416956 , 26496610 , 28514442 , (Europe PMC )0.49 BioGRID, IntAct FCHSD2 Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, two hybrid physical, physical association 18654987 , (Europe PMC )0.51 BioGRID, IntAct GRB2 Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.57 BioGRID, IntAct HIF1A anti tag coimmunoprecipitation association 18775313 , (Europe PMC )0.35 IntAct HLA-B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HMGCR Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 21343306 , (Europe PMC )0.35 BioGRID, IntAct IFT88 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26389662 , 27173435 , (Europe PMC )0.35 BioGRID, IntAct IKBKE Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct ITGB4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KIF20A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct L3MBTL1 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 22120668 , 23652004 , (Europe PMC )0.40 BioGRID, IntAct LNX1 Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct MAP3K3 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MAPK8IP2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MCC Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MFN2 anti tag coimmunoprecipitation physical association 23498974 , (Europe PMC )0.40 IntAct NCAPH Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23383273 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct NDRG1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17220478 , (Europe PMC )0.40 BioGRID, IntAct NEURL4 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct NFKBIA Affinity Capture-Western, Reconstituted Complex, tandem affinity purification physical, physical association 10930447 , 14743216 , 23383273 , 23393163 , 24248593 , 26463447 , 9452483 , (Europe PMC )0.40 BioGRID, IntAct NFKBIB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NFKBIE tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NGLY1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical 15362974 , 16807242 , 20414249 , 22119785 , (Europe PMC )0.35 BioGRID, IntAct, MINT NPLOC4 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, molecular sieving, pull down association, physical, physical association 15371428 , 16234241 , 17872946 , 18586029 , 18775313 , 20414249 , 21645854 , 23293021 , 23333620 , 26389662 , 26549226 , 27226613 , 27913212 , (Europe PMC )0.77 BioGRID, IntAct, MINT NSFL1C Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, filter binding, isothermal titration calorimetry, two hybrid association, direct interaction, physical, physical association 12473691 , 12810701 , 16234241 , 16275660 , 18775313 , 20414249 , 21645854 , 21900206 , 21949850 , 22350894 , 22466964 , 23443559 , 25078495 , 25416956 , 25775548 , 26344197 , 26389662 , 26496610 , 26712280 , 27226613 , 27785701 , 27913212 , 28514442 , (Europe PMC )0.92 BioGRID, IntAct, MINT OPTN two hybrid fragment pooling approach physical association 23414517 , (Europe PMC )0.37 IntAct PDK3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PIK3R3 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PLAA Affinity Capture-Western, Co-crystal Structure, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 19887378 , 25416956 , (Europe PMC )0.49 BioGRID, IntAct PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PPM1B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , 23443559 , (Europe PMC )0.40 BioGRID, IntAct PPP1CA anti bait coimmunoprecipitation association, physical association 25593058 , (Europe PMC )0.50 IntAct PPP1R18 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PSAP anti bait coimmunoprecipitation physical association 19570996 , (Europe PMC )0.40 IntAct PSMA1 Affinity Capture-Western, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 23393163 , 25416956 , (Europe PMC )0.49 BioGRID, IntAct PSMA7 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PTPN22 Affinity Capture-MS, pull down association, physical 16461343 , (Europe PMC )0.35 BioGRID, IntAct PTPN3 anti tag coimmunoprecipitation, pull down physical association 10364224 , (Europe PMC )0.52 IntAct RPL9 Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct RPS6KA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RXRB display technology physical association 20195357 , (Europe PMC )0.40 IntAct SCHIP1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct SEM1 anti tag coimmunoprecipitation association 24811749 , (Europe PMC )0.35 IntAct, MINT SGK1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct SH2D2A Affinity Capture-MS, Affinity Capture-Western, Far Western, pull down association, physical 15752563 , (Europe PMC )0.35 BioGRID, IntAct, MINT SIK2 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-fractionation, Reconstituted Complex, tandem affinity purification association, physical 16306228 , 24129571 , 24841198 , (Europe PMC )0.35 BioGRID, IntAct SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SYF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYVN1 Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 16186510 , 16289116 , 16822850 , 17872946 , 20414249 , 24100225 , 26424800 , 26471130 , (Europe PMC )0.46 BioGRID, IntAct, MINT TFE3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TNFRSF14 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TOM1L1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TP53BP1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TP63 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 20085233 , (Europe PMC )0.35 BioGRID, IntAct TRAF6 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification physical, physical association 14743216 , 17353931 , (Europe PMC )0.59 BioGRID, IntAct TUBA1A pull down association 27291054 , (Europe PMC )0.35 IntAct TUBB3 Co-fractionation, pull down association, physical 26344197 , 27291054 , (Europe PMC )0.35 BioGRID, IntAct UBE4B pull down direct interaction 26712280 , (Europe PMC )0.44 IntAct UBXN1 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation association, physical 15362974 , 18775313 , 21135095 , 25416956 , 26389662 , 27785701 , (Europe PMC )0.35 BioGRID, IntAct UBXN10 anti tag coimmunoprecipitation association 18775313 , (Europe PMC )0.35 IntAct UBXN2A Affinity Capture-MS, Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 18775313 , 21900206 , 23443559 , 26389662 , 28514442 , (Europe PMC )0.62 BioGRID, IntAct, MINT UBXN2B Affinity Capture-MS, Reconstituted Complex, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 18775313 , 25416956 , 25775548 , 26186194 , 26389662 , 28514442 , (Europe PMC )0.49 BioGRID, IntAct UBXN4 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation association, physical, physical association 16968747 , 18775313 , 19822669 , 25078495 , 26389662 , (Europe PMC )0.50 BioGRID, IntAct UBXN6 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, molecular sieving, pull down, two hybrid association, direct interaction, physical association 18656546 , 18775313 , (Europe PMC )0.76 IntAct UBXN7 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Reconstituted Complex, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach association, physical, physical association 18775313 , 22466964 , 26389662 , 28274878 , (Europe PMC )0.75 BioGRID, IntAct UBXN8 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation association, physical 18775313 , 21949850 , 25078495 , 26389662 , (Europe PMC )0.35 BioGRID, IntAct UFD1 anti tag coimmunoprecipitation, pull down, x-ray crystallography association, direct interaction 18775313 , 20414249 , 26712280 , (Europe PMC )0.74 IntAct, MINT VCAM1 Affinity Capture-MS, Affinity Capture-Western, cross-linking study association, physical 19738201 , 22623428 , 26337389 , (Europe PMC )0.35 BioGRID, IntAct VCP Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Reconstituted Complex, Two-hybrid, atomic force microscopy, electron tomography, ion mobility mass spectrometry of complexes, transmission electron microscopy, x-ray crystallography direct interaction, physical 10350210 , 12807884 , 16621797 , 17525332 , 18044963 , 20512113 , 22270372 , 23383273 , 24055316 , 25416956 , 26712278 , 26822609 , 26849035 , (Europe PMC )0.85 BioGRID, IntAct, MINT VCPIP1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 19615732 , 21811234 , 23500464 , 24163436 , 26389662 , (Europe PMC )0.40 BioGRID, IntAct VPS18 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct WDYHV1 Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct WRAP73 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct WRN Affinity Capture-Western, pull down physical, physical association 12937274 , 15037256 , (Europe PMC )0.40 BioGRID, IntAct YOD1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 19818707 , 24417208 , 28244869 , (Europe PMC )0.49 BioGRID, IntAct YWHAZ Affinity Capture-MS, Two-hybrid, pull down, two hybrid array physical, physical association 15161933 , 21988832 , 23383273 , (Europe PMC )0.57 BioGRID, IntAct, MINT ZNF778 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ATXN3 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, competition binding, cosedimentation through density gradient, fluorescence microscopy, peptide array, pull down association, colocalization, direct interaction, physical, physical association 12944474 , 14749733 , 16525503 , 16822850 , 18199748 , 19175675 , 19843543 , 20414249 , 22970133 , 23383273 , 24100225 , 25231079 , 27851749 , 28180282 , 28275011 , (Europe PMC )0.40, 0.83 BioGRID, IntAct, MINT CANX Affinity Capture-MS, Co-fractionation, cosedimentation through density gradient colocalization, physical 17948026 , 23383273 , 26344197 , (Europe PMC )0.35 BioGRID, IntAct, MINT CD247 pull down association 24502978 , (Europe PMC )0.35 IntAct, MINT CRMP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DGAT2 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 24820123 , (Europe PMC )0.40 BioGRID, IntAct, MINT JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAPK8IP2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NGLY1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical 15362974 , 16807242 , 20414249 , 22119785 , (Europe PMC )0.35 BioGRID, IntAct, MINT NPLOC4 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, molecular sieving, pull down association, physical, physical association 15371428 , 16234241 , 17872946 , 18586029 , 18775313 , 20414249 , 21645854 , 23293021 , 23333620 , 26389662 , 26549226 , 27226613 , 27913212 , (Europe PMC )0.77 BioGRID, IntAct, MINT NSFL1C Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, filter binding, isothermal titration calorimetry, two hybrid association, direct interaction, physical, physical association 12473691 , 12810701 , 16234241 , 16275660 , 18775313 , 20414249 , 21645854 , 21900206 , 21949850 , 22350894 , 22466964 , 23443559 , 25078495 , 25416956 , 25775548 , 26344197 , 26389662 , 26496610 , 26712280 , 27226613 , 27785701 , 27913212 , 28514442 , (Europe PMC )0.92 BioGRID, IntAct, MINT RPS6KA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SEM1 anti tag coimmunoprecipitation association 24811749 , (Europe PMC )0.35 IntAct, MINT SH2D2A Affinity Capture-MS, Affinity Capture-Western, Far Western, pull down association, physical 15752563 , (Europe PMC )0.35 BioGRID, IntAct, MINT SYVN1 Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 16186510 , 16289116 , 16822850 , 17872946 , 20414249 , 24100225 , 26424800 , 26471130 , (Europe PMC )0.46 BioGRID, IntAct, MINT TOM1L1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBXN2A Affinity Capture-MS, Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 18775313 , 21900206 , 23443559 , 26389662 , 28514442 , (Europe PMC )0.62 BioGRID, IntAct, MINT UFD1 anti tag coimmunoprecipitation, pull down, x-ray crystallography association, direct interaction 18775313 , 20414249 , 26712280 , (Europe PMC )0.74 IntAct, MINT VCP Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Reconstituted Complex, Two-hybrid, atomic force microscopy, electron tomography, ion mobility mass spectrometry of complexes, transmission electron microscopy, x-ray crystallography direct interaction, physical 10350210 , 12807884 , 16621797 , 17525332 , 18044963 , 20512113 , 22270372 , 23383273 , 24055316 , 25416956 , 26712278 , 26822609 , 26849035 , (Europe PMC )0.85 BioGRID, IntAct, MINT YWHAZ Affinity Capture-MS, Two-hybrid, pull down, two hybrid array physical, physical association 15161933 , 21988832 , 23383273 , (Europe PMC )0.57 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCC3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ACACA Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ACTB Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID ACTN1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ACTN4 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ADD1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ADRB2 Affinity Capture-MS physical 23798571 , (Europe PMC )NA BioGRID AKT1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity physical 16027165 , 16551632 , 23383273 , (Europe PMC )NA BioGRID ALDH18A1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ALS2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID AMFR Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, filter binding, fluorescence microscopy, pull down association, direct interaction, physical, physical association 15331598 , 16186510 , 16275660 , 16407162 , 16987818 , 17311810 , 17681147 , 17872946 , 18835813 , 19828134 , 20126661 , 21343306 , 21636303 , 21914798 , 22119785 , 22328510 , 23333620 , 23383273 , 24100225 , 26424800 , 26712280 , (Europe PMC )0.83 BioGRID, IntAct ANAPC7 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ANKHD1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ANKLE2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID ANKRD13A Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 26797118 , (Europe PMC )NA BioGRID ANKRD13B Affinity Capture-MS, Affinity Capture-Western physical 26797118 , (Europe PMC )NA BioGRID ANKRD13D Affinity Capture-MS, Affinity Capture-Western physical 26797118 , (Europe PMC )NA BioGRID ANKZF1 Affinity Capture-Western, Protein-peptide, Two-hybrid physical 21896481 , 21914798 , (Europe PMC )NA BioGRID ANXA2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ANXA5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ANXA7 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID AP1B1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID AP2A2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID APOA1 Affinity Capture-Western physical 19164805 , (Europe PMC )NA BioGRID APOB Affinity Capture-Western physical 18550891 , 19164805 , 28183703 , (Europe PMC )NA BioGRID APPL1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID AR Affinity Capture-Western, Reconstituted Complex physical 23652004 , (Europe PMC )NA BioGRID ARF6 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARFGAP2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARFGEF2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARHGAP17 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARHGEF2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARIH1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARIH2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARPC2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ARRB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 17620599 , (Europe PMC )0.35 BioGRID, IntAct ASPM pull down association 28436967 , (Europe PMC )0.35 IntAct ASPSCR1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 18775313 , 21900206 , 22350894 , 23383273 , 23443559 , 25078495 , 25416956 , 26389662 , 26496610 , 28514442 , (Europe PMC )0.81 BioGRID, IntAct, MINT ATAD3A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATAD3B Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATG5 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID ATG9A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ATXN1 Affinity Capture-Western, Reconstituted Complex physical 23652004 , (Europe PMC )NA BioGRID ATXN10 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ATXN3 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, competition binding, cosedimentation through density gradient, fluorescence microscopy, peptide array, pull down association, colocalization, direct interaction, physical, physical association 12944474 , 14749733 , 16525503 , 16822850 , 18199748 , 19175675 , 19843543 , 20414249 , 22970133 , 23383273 , 24100225 , 25231079 , 27851749 , 28180282 , 28275011 , (Europe PMC )0.40, 0.83 BioGRID, IntAct, MINT ATXN7 Affinity Capture-Western, Reconstituted Complex physical 23652004 , (Europe PMC )NA BioGRID AUP1 Affinity Capture-MS, Affinity Capture-Western physical 21857022 , (Europe PMC )NA BioGRID AVPR2 Affinity Capture-Western physical 18048502 , (Europe PMC )NA BioGRID BAD Affinity Capture-Western physical 23383273 , (Europe PMC )NA BioGRID BAG2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BAG6 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation physical 21636303 , 23383273 , 23665563 , (Europe PMC )NA BioGRID BAIAP2L1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BAX Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BCAR3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct BCCIP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BCLAF1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BID Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BLM Synthetic Growth Defect genetic 24104479 , (Europe PMC )NA BioGRID BRAT1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BRCA1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 10855792 , 26831064 , (Europe PMC )NA BioGRID BRSK2 Affinity Capture-Western, Reconstituted Complex physical 23907667 , (Europe PMC )NA BioGRID BSG Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID BTRC Affinity Capture-Western physical 24248593 , 24429874 , 26112410 , (Europe PMC )NA BioGRID BUD23 Two-hybrid physical 21988832 , (Europe PMC )NA BioGRID BUD23 two hybrid physical association 21988832 , (Europe PMC )0.37 IntAct BZW2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CAAP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CAB39 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CACNA1C Affinity Capture-Western physical 21186355 , (Europe PMC )NA BioGRID CALR Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CALU Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CANX Affinity Capture-MS, Co-fractionation, cosedimentation through density gradient colocalization, physical 17948026 , 23383273 , 26344197 , (Europe PMC )0.35 BioGRID, IntAct, MINT CASP7 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CASP9 Affinity Capture-Western physical 23383273 , (Europe PMC )NA BioGRID CASR Affinity Capture-Western physical 16513638 , (Europe PMC )NA BioGRID CAV1 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 23335559 , 24089527 , (Europe PMC )NA BioGRID CCDC134 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CCDC8 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CCNB1 Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID CCT2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 23190606 , 23383273 , (Europe PMC )NA BioGRID CCT3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CCT4 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CCT5 Affinity Capture-MS, Co-fractionation physical 22939629 , 23383273 , (Europe PMC )NA BioGRID CCT6A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CCT7 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CCT8 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CD247 pull down association 24502978 , (Europe PMC )0.35 IntAct, MINT CD3D Affinity Capture-Western physical 15331598 , 17872946 , (Europe PMC )NA BioGRID CD4 Affinity Capture-Western physical 22090097 , (Europe PMC )NA BioGRID CDC25A Affinity Capture-Western physical 24429874 , (Europe PMC )NA BioGRID CDC27 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CDC37 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CDC42EP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CDC42EP4 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CDC73 Affinity Capture-MS physical 27462432 , (Europe PMC )NA BioGRID CDK1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CDK2 Affinity Capture-MS physical 21319273 , 23443559 , (Europe PMC )NA BioGRID CDK2AP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CDK4 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CDKN1A Affinity Capture-Western physical 23383273 , (Europe PMC )NA BioGRID CDKN1B Affinity Capture-Western physical 23383273 , (Europe PMC )NA BioGRID CDKN2AIP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CENPH Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CEP19 Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct CEP55 Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID CFTR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 16621797 , 16954204 , 17110338 , 17272822 , 18216283 , 19828134 , 26618866 , (Europe PMC )0.35 BioGRID, IntAct CHEK1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CHEK2 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17525332 , (Europe PMC )0.52 BioGRID, IntAct CHMP4B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CIDEC Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CIP2A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CLASP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CLGN Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CLN6 Affinity Capture-Western physical 18811591 , (Europe PMC )NA BioGRID CLTA Affinity Capture-Western physical 8413590 , (Europe PMC )NA BioGRID CLUAP1 Reconstituted Complex physical 26389662 , (Europe PMC )NA BioGRID CNOT10 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CNOT2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CNOT8 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CNOT9 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COG4 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COG5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COIL Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COMMD1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COMMD6 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COMT Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COPE Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COPS3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COPS5 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex physical 19826004 , 21145461 , (Europe PMC )NA BioGRID COPS7A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID COQ8A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CRBN Affinity Capture-MS physical 26990986 , (Europe PMC )NA BioGRID CRMP1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CRY2 Affinity Capture-MS physical 25756610 , (Europe PMC )NA BioGRID CSK Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CSNK2B Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CTNNA1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CTNNBL1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CTNND1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CUL1 Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 18775313 , 22466964 , 26112410 , (Europe PMC )0.35 BioGRID, IntAct CUL2 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 18775313 , 21145461 , 22466964 , (Europe PMC )0.53 BioGRID, IntAct CUL3 Affinity Capture-MS, Affinity Capture-Western physical 21145461 , 22466964 , (Europe PMC )NA BioGRID CUL4A Affinity Capture-Western, anti tag coimmunoprecipitation association, physical, physical association 22466964 , (Europe PMC )0.50 BioGRID, IntAct CUL5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 23383273 , 24711643 , (Europe PMC )NA BioGRID CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID DAP3 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID DCAF11 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID DCAF7 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID DDIAS Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID DDX54 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID DERL1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Protein-peptide, Reconstituted Complex physical 16186509 , 16186510 , 16289116 , 16901789 , 17872946 , 18199748 , 21909096 , 22119785 , 27714797 , 28137758 , (Europe PMC )NA BioGRID DERL1 anti bait coimmunoprecipitation association 16901789 , (Europe PMC )0.35 IntAct DERL2 Affinity Capture-MS, Affinity Capture-Western physical 16186509 , 21909096 , 22119785 , 23867461 , (Europe PMC )NA BioGRID DGAT2 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 24820123 , (Europe PMC )0.40 BioGRID, IntAct, MINT DGCR6 Two-hybrid physical 24722188 , (Europe PMC )NA BioGRID DIAPH3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID DIO2 Affinity Capture-Western physical 24196352 , (Europe PMC )NA BioGRID DLD Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DNAJB11 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID DNAJB9 Affinity Capture-Western physical 18400946 , (Europe PMC )NA BioGRID DNAJC10 Affinity Capture-Western physical 18400946 , (Europe PMC )NA BioGRID DNM1L Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DNM3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID DOCK7 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID DSP Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID DSTN Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID DTNB Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct DUSP9 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID DYNC1I2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID DYNC1LI1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID EBI-1059081 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ECH1 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct EEA1 Affinity Capture-Western physical 21556036 , (Europe PMC )NA BioGRID EEF1A2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID EIF4A2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID EIF5A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ELAVL1 Affinity Capture-Western, Reconstituted Complex physical 23618873 , (Europe PMC )NA BioGRID ENTR1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID EPPK1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID ERCC6 Affinity Capture-Western physical 26826127 , (Europe PMC )NA BioGRID ERCC8 Affinity Capture-Western physical 26826127 , (Europe PMC )NA BioGRID ESPL1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ESR1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID ESS2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID EZH2 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID F7 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID FAF1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti tag coimmunoprecipitation, molecular sieving, pull down, x-ray crystallography association, direct interaction, physical, physical association 15743842 , 18775313 , 20057067 , 21645854 , 21914798 , 22102026 , 22350894 , 23293021 , 23383273 , 24885147 , 26389662 , 26842564 , (Europe PMC )0.50, 0.62 BioGRID, IntAct FAF2 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 18711132 , 18775313 , 18835813 , 22119785 , 22350894 , 22466964 , 23665563 , 25078495 , 26389662 , (Europe PMC )0.56 BioGRID, IntAct FAM104A Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 23443559 , 25416956 , 26496610 , 28514442 , (Europe PMC )0.49 BioGRID, IntAct FAM189B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FANCI Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID FBF1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID FBXL2 Affinity Capture-Western physical 28614300 , (Europe PMC )NA BioGRID FBXO2 Affinity Capture-Western physical 15723043 , (Europe PMC )NA BioGRID FBXO6 Affinity Capture-Western physical 15723043 , (Europe PMC )NA BioGRID FBXW11 Affinity Capture-Western physical 24248593 , (Europe PMC )NA BioGRID FCHSD2 Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, two hybrid physical, physical association 18654987 , (Europe PMC )0.51 BioGRID, IntAct FERMT2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID FHOD1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID FKBP15 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID FLNB Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID FN1 Affinity Capture-MS physical 19738201 , (Europe PMC )NA BioGRID FUS Affinity Capture-MS, Affinity Capture-Western physical 25192599 , (Europe PMC )NA BioGRID G3BP1 Affinity Capture-MS physical 26777405 , (Europe PMC )NA BioGRID G3BP2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GABRA1 Affinity Capture-Western physical 26945068 , (Europe PMC )NA BioGRID GBF1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GET4 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GGA1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GGA2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GIGYF2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID GLB1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID GOLPH3L Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.57 BioGRID, IntAct GRIN2D Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID GRWD1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID GTF3C1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GTF3C3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID GTF3C5 Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID GZMK Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity physical 20876349 , (Europe PMC )NA BioGRID H2AFJ Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID H2AFV Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID HAUS1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HDAC5 Affinity Capture-MS physical 21081666 , (Europe PMC )NA BioGRID HDLBP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HEATR1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HELLS Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HERPUD1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex physical 16289116 , (Europe PMC )NA BioGRID HEY1 Affinity Capture-MS physical 27129302 , (Europe PMC )NA BioGRID HIF1A Affinity Capture-Western physical 18775313 , (Europe PMC )NA BioGRID HIF1A anti tag coimmunoprecipitation association 18775313 , (Europe PMC )0.35 IntAct HIP1R Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HLA-A Affinity Capture-Western physical 20702414 , (Europe PMC )NA BioGRID HLA-B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HLA-DRB1 Affinity Capture-Western physical 18022694 , (Europe PMC )NA BioGRID HMGCR Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 21343306 , (Europe PMC )0.35 BioGRID, IntAct HNF1A Affinity Capture-MS physical 18160415 , (Europe PMC )NA BioGRID HNRNPA1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HNRNPH1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID HNRNPH2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HNRNPH3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HNRNPK Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HOOK1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HS1BP3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HSBP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HSP90AA1 Affinity Capture-MS, Affinity Capture-Western physical 16621797 , 23383273 , (Europe PMC )NA BioGRID HSP90AB1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HSP90B1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSP90B2P Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HSPA1A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HSPA4 Affinity Capture-MS, Affinity Capture-Western physical 16621797 , 23383273 , (Europe PMC )NA BioGRID HSPA5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation physical 16621797 , 22939629 , 23383273 , (Europe PMC )NA BioGRID HSPB1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HSPD1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID HSPE1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID HTRA2 Affinity Capture-MS physical 26389662 , (Europe PMC )NA BioGRID HTT Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 20126661 , 23383273 , 23652004 , (Europe PMC )NA BioGRID HUWE1 Affinity Capture-MS physical 23383273 , 25147182 , (Europe PMC )NA BioGRID ICK Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID IFT74 Affinity Capture-MS physical 26389662 , (Europe PMC )NA BioGRID IFT88 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26389662 , 27173435 , (Europe PMC )0.35 BioGRID, IntAct IKBKE Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct INF2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID INSIG1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 16168377 , 18835813 , 19815544 , (Europe PMC )NA BioGRID INSIG2 Affinity Capture-MS, Reconstituted Complex physical 19815544 , (Europe PMC )NA BioGRID IPO4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID IQCB1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID IQGAP1 Affinity Capture-MS, Affinity Capture-Western, Co-localization physical 23443559 , 28970065 , (Europe PMC )NA BioGRID IQGAP2 Affinity Capture-Western physical 28970065 , (Europe PMC )NA BioGRID IQGAP3 Affinity Capture-Western physical 28970065 , (Europe PMC )NA BioGRID IRS4 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID ISG15 Affinity Capture-MS physical 16009940 , (Europe PMC )NA BioGRID ISYNA1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID ITGB1 Affinity Capture-Western physical 15723043 , (Europe PMC )NA BioGRID ITGB4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ITPR1 Affinity Capture-Western physical 19240031 , (Europe PMC )NA BioGRID ITPR3 Affinity Capture-Western physical 28614300 , (Europe PMC )NA BioGRID JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KCMF1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID KDM3B Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID KDSR Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KIF1BP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID KIF20A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct L3MBTL1 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 22120668 , 23652004 , (Europe PMC )0.40 BioGRID, IntAct LMAN1 Affinity Capture-MS physical 22337587 , (Europe PMC )NA BioGRID LMNA Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID LMNB2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID LNPK Affinity Capture-MS physical 27716508 , (Europe PMC )NA BioGRID LNX1 Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct LRBA Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID LRIG1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID LYAR Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MAP1LC3A Co-localization physical 21909394 , (Europe PMC )NA BioGRID MAP2K1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MAP3K3 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MAP7D3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MAPK1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MAPK13 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MAPK3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MAPK8IP2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MARK2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MCC Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MCM2 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MDM2 Affinity Capture-MS physical 23383273 , 24147044 , (Europe PMC )NA BioGRID MDN1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MFN2 anti tag coimmunoprecipitation physical association 23498974 , (Europe PMC )0.40 IntAct MRPS18B Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID MRPS23 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID MSH4 Affinity Capture-Western physical 23964080 , (Europe PMC )NA BioGRID MTOR Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID MUS81 Synthetic Growth Defect genetic 24104479 , (Europe PMC )NA BioGRID NACA2 Co-fractionation physical 22939629 , 26344197 , (Europe PMC )NA BioGRID NAPA Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NASP Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID NBEA Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NCAPH Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23383273 , 26496610 , (Europe PMC )0.35 BioGRID, IntAct NCDN Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NCOA1 Affinity Capture-MS physical 16051665 , (Europe PMC )NA BioGRID NDRG1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17220478 , (Europe PMC )0.40 BioGRID, IntAct NEK2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NEPRO Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NEURL4 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct NF1 Affinity Capture-Western, Reconstituted Complex physical 22105171 , (Europe PMC )NA BioGRID NFKB1 Affinity Capture-Western physical 26112410 , (Europe PMC )NA BioGRID NFKB2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NFKBIA Affinity Capture-Western, Reconstituted Complex, tandem affinity purification physical, physical association 10930447 , 14743216 , 23383273 , 23393163 , 24248593 , 26463447 , 9452483 , (Europe PMC )0.40 BioGRID, IntAct NFKBIB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NFKBIE tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NGLY1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation association, physical 15362974 , 16807242 , 20414249 , 22119785 , (Europe PMC )0.35 BioGRID, IntAct, MINT NIPSNAP1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID NIPSNAP2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID NMD3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NME2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NOS2 Affinity Capture-MS physical 23438482 , (Europe PMC )NA BioGRID NPLOC4 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, molecular sieving, pull down association, physical, physical association 15371428 , 16234241 , 17872946 , 18586029 , 18775313 , 20414249 , 21645854 , 23293021 , 23333620 , 26389662 , 26549226 , 27226613 , 27913212 , (Europe PMC )0.77 BioGRID, IntAct, MINT NPM1 Affinity Capture-MS physical 23402259 , (Europe PMC )NA BioGRID NSF Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NSFL1C Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, filter binding, isothermal titration calorimetry, two hybrid association, direct interaction, physical, physical association 12473691 , 12810701 , 16234241 , 16275660 , 18775313 , 20414249 , 21645854 , 21900206 , 21949850 , 22350894 , 22466964 , 23443559 , 25078495 , 25416956 , 25775548 , 26344197 , 26389662 , 26496610 , 26712280 , 27226613 , 27785701 , 27913212 , 28514442 , (Europe PMC )0.92 BioGRID, IntAct, MINT NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NUB1 Affinity Capture-Western, Reconstituted Complex physical 24019527 , 24100225 , (Europe PMC )NA BioGRID NUMA1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NUP107 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NUP205 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NUP54 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID NUP58 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID NUP62 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID OPTN two hybrid fragment pooling approach physical association 23414517 , (Europe PMC )0.37 IntAct OS9 Affinity Capture-MS physical 23097496 , (Europe PMC )NA BioGRID OTULIN Co-fractionation, Protein-peptide physical 24726323 , (Europe PMC )NA BioGRID P4HB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PACRG Affinity Capture-Western physical 14532270 , (Europe PMC )NA BioGRID PDCD10 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PDCD4 Affinity Capture-MS, Affinity Capture-Western physical 23383273 , (Europe PMC )NA BioGRID PDCD6 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PDK3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PDXDC1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PEX19 Affinity Capture-Western physical 23457492 , (Europe PMC )NA BioGRID PHB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PHKG2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID PIK3C2B Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PIK3R2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PIK3R3 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PKM Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PKN2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PLAA Affinity Capture-Western, Co-crystal Structure, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 19887378 , 25416956 , (Europe PMC )0.49 BioGRID, IntAct PLEC Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PLK1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PLPP3 Affinity Capture-Western physical 26549226 , (Europe PMC )NA BioGRID PNO1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID POLR2A Affinity Capture-Western physical 28036256 , (Europe PMC )NA BioGRID POLR2B Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID POLR3C Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PPFIBP1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID PPM1B Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , 23443559 , (Europe PMC )0.40 BioGRID, IntAct PPP1CA anti bait coimmunoprecipitation association, physical association 25593058 , (Europe PMC )0.50 IntAct PPP1CC Affinity Capture-MS, Affinity Capture-Western physical 17683050 , (Europe PMC )NA BioGRID PPP1R18 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP2CA Affinity Capture-Western physical 20100830 , 23108140 , (Europe PMC )NA BioGRID PPP2CB Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PPP2R1A Affinity Capture-Western physical 20100830 , 23108140 , (Europe PMC )NA BioGRID PPP3CA Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID PPP6C Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PPT1 Affinity Capture-MS, Affinity Capture-Western physical 25865307 , (Europe PMC )NA BioGRID PRKAA1 Affinity Capture-MS physical 16306228 , (Europe PMC )NA BioGRID PRKAG1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PRKAR2A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PRKCD Reconstituted Complex physical 20395553 , (Europe PMC )NA BioGRID PRKN Affinity Capture-MS, Affinity Capture-Western physical 14532270 , 23503661 , 28514442 , (Europe PMC )NA BioGRID PRMT3 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PRMT5 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PRPF19 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID PRPF31 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID PRPF4 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID PSAP anti bait coimmunoprecipitation physical association 19570996 , (Europe PMC )0.40 IntAct PSMA1 Affinity Capture-Western, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 23393163 , 25416956 , (Europe PMC )0.49 BioGRID, IntAct PSMA2 Affinity Capture-MS, Co-fractionation physical 19193609 , 22939629 , (Europe PMC )NA BioGRID PSMA3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PSMA4 Co-fractionation physical 22939629 , 26344197 , (Europe PMC )NA BioGRID PSMA6 Affinity Capture-Western physical 19822669 , (Europe PMC )NA BioGRID PSMA7 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PSMC1 Affinity Capture-Western physical 9452483 , (Europe PMC )NA BioGRID PSMC4 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID PSMC5 Affinity Capture-Western physical 26337389 , (Europe PMC )NA BioGRID PSMD4 Affinity Capture-Western physical 15362974 , 24196352 , (Europe PMC )NA BioGRID PTCRA Affinity Capture-Western physical 22795130 , (Europe PMC )NA BioGRID PTGES3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PTGS2 Affinity Capture-Western physical 24089527 , (Europe PMC )NA BioGRID PTPN22 Affinity Capture-MS, pull down association, physical 16461343 , (Europe PMC )0.35 BioGRID, IntAct PTPN23 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PTPN3 anti tag coimmunoprecipitation, pull down physical association 10364224 , (Europe PMC )0.52 IntAct PTPN9 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID PTPRO Affinity Capture-MS, Affinity Capture-Western physical 23533167 , (Europe PMC )NA BioGRID RAB10 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RAB11B Affinity Capture-MS, Co-fractionation physical 23383273 , 26344197 , (Europe PMC )NA BioGRID RAB14 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RAB3GAP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RAB3GAP2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RAB7A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RABGAP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RAD23A Affinity Capture-Western physical 22970133 , (Europe PMC )NA BioGRID RAF1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RANBP2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RBBP4 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RBFOX2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RBM23 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RCN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RDX Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RELCH Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RFC3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RFC5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RHBDD1 Co-crystal Structure, Reconstituted Complex physical 27407164 , (Europe PMC )NA BioGRID RHBDL3 Affinity Capture-Western physical 22795130 , (Europe PMC )NA BioGRID RIF1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RNF103 Affinity Capture-Western physical 18675248 , (Europe PMC )NA BioGRID RNF126 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RNF19A Affinity Capture-Western, Reconstituted Complex physical 15456787 , 16513638 , (Europe PMC )NA BioGRID RNF2 Affinity Capture-MS physical 23383273 , 24457600 , (Europe PMC )NA BioGRID RNF31 Affinity Capture-MS, Co-crystal Structure, Protein-peptide, Reconstituted Complex physical 24726323 , 24726327 , (Europe PMC )NA BioGRID RNF7 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RNF8 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID RPA2 Affinity Capture-Western physical 28575658 , (Europe PMC )NA BioGRID RPL13 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPL18A Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPL22 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPL23 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPL24 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPL30 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPL6 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RPL9 Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct RPN1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RPN2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RPS11 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPS13 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RPS25 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPS3 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPS3A Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPS4X Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPS6 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPS6KA1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RPS8 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RPS9 Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID RRBP1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RRP12 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RSU1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID RUVBL2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID RXRB display technology physical association 20195357 , (Europe PMC )0.40 IntAct SAP18 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SCD Affinity Capture-Western, Co-fractionation physical 16723740 , 26344197 , (Europe PMC )NA BioGRID SCFD1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SCHIP1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct SEC16A Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SEC22B Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SELENOS Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 15215856 , 16289116 , 17872946 , 18199748 , 21832065 , 22119785 , 24424410 , 24700463 , 25008318 , 26549226 , (Europe PMC )NA BioGRID SEM1 Affinity Capture-MS, Affinity Capture-Western physical 24811749 , (Europe PMC )NA BioGRID SEM1 anti tag coimmunoprecipitation association 24811749 , (Europe PMC )0.35 IntAct, MINT SENP3 Affinity Capture-MS physical 26511642 , (Europe PMC )NA BioGRID SERPINA1 Affinity Capture-Western physical 21135095 , (Europe PMC )NA BioGRID SESN2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SFTPC Affinity Capture-Western physical 19815549 , (Europe PMC )NA BioGRID SGK1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct SH2D1A Affinity Capture-Western physical 19570996 , (Europe PMC )NA BioGRID SH2D2A Affinity Capture-MS, Affinity Capture-Western, Far Western, pull down association, physical 15752563 , (Europe PMC )0.35 BioGRID, IntAct, MINT SIK2 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-fractionation, Reconstituted Complex, tandem affinity purification association, physical 16306228 , 24129571 , 24841198 , (Europe PMC )0.35 BioGRID, IntAct SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SKP1 Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID SLC17A2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SLC25A3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SLC3A2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SLIRP Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID SLX4 Affinity Capture-MS physical 22902628 , (Europe PMC )NA BioGRID SMARCA5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SMARCC1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SMURF1 Affinity Capture-MS physical 23184937 , (Europe PMC )NA BioGRID SNX3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SOD1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct SON Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SPAST Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SPC24 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SPRTN Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex physical 22902628 , 23042605 , 23042607 , (Europe PMC )NA BioGRID SPTAN1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID SRRM2 Affinity Capture-MS physical 16159877 , (Europe PMC )NA BioGRID SRSF11 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SRSF3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ST13 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID STAG2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID STAM2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID STAT1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID STIP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STMN1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID STUB1 Affinity Capture-Western, Reconstituted Complex physical 16621797 , 24100225 , (Europe PMC )NA BioGRID SUMO1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SUMO2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SUPT16H Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID SUPT6H Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID SUZ12 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID SVIP Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Co-localization, Protein-peptide, Reconstituted Complex physical 17872946 , 21909394 , 21914798 , 24100225 , (Europe PMC )NA BioGRID SYF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYMPK Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID SYVN1 Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical 16186510 , 16289116 , 16822850 , 17872946 , 20414249 , 24100225 , 26424800 , 26471130 , (Europe PMC )0.46 BioGRID, IntAct, MINT TAF6L Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TARDBP Affinity Capture-MS, Affinity Capture-Western physical 19237541 , 20020773 , (Europe PMC )NA BioGRID TAX1BP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TBC1D10B Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TBC1D9B Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TCP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TDP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TELO2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TERF2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TFE3 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TIMM44 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID TKT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TLE3 Affinity Capture-Western physical 28689657 , (Europe PMC )NA BioGRID TMED10 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TMEM129 Affinity Capture-Western physical 24807418 , (Europe PMC )NA BioGRID TMEM33 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TMPRSS13 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID TNFRSF14 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TNKS1BP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TNPO3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TOM1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TOM1L1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TOMM34 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 11913976 , (Europe PMC )NA BioGRID TOP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TP53 Affinity Capture-MS, Affinity Capture-Western physical 23383273 , 23443559 , (Europe PMC )NA BioGRID TP53BP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TP53BP1 proximity-dependent biotin identification association 29656893 , (Europe PMC )0.35 IntAct TP63 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 20085233 , (Europe PMC )0.35 BioGRID, IntAct TPD52L2 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID TPM3P4 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TRA Affinity Capture-Western physical 21636303 , (Europe PMC )NA BioGRID TRAF6 Affinity Capture-MS, anti bait coimmunoprecipitation, tandem affinity purification physical, physical association 14743216 , 17353931 , (Europe PMC )0.59 BioGRID, IntAct TRIM13 Affinity Capture-MS, Affinity Capture-Western physical 17314412 , (Europe PMC )NA BioGRID TRIM21 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-MS physical 23383273 , 29117863 , (Europe PMC )NA BioGRID TRIP12 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TSG101 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TTC26 Affinity Capture-MS physical 26389662 , (Europe PMC )NA BioGRID TTC4 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TTK Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TTR Affinity Capture-Western physical 26565908 , (Europe PMC )NA BioGRID TUBA1A pull down association 27291054 , (Europe PMC )0.35 IntAct TUBA1C Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID TUBB Affinity Capture-MS, Co-fractionation physical 23443559 , 26344197 , (Europe PMC )NA BioGRID TUBB2B Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TUBB3 Co-fractionation, pull down association, physical 26344197 , 27291054 , (Europe PMC )0.35 BioGRID, IntAct TUBB4B Affinity Capture-MS, Co-fractionation physical 23443559 , 26344197 , (Europe PMC )NA BioGRID TUBGCP2 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID TXN2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TXNDC5 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID U2AF2 Affinity Capture-MS physical 26641092 , (Europe PMC )NA BioGRID UBA5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID UBB Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID UBC Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 11483959 , 16196087 , 16822850 , 17550899 , 27407164 , 28190767 , (Europe PMC )NA BioGRID UBE2J1 Affinity Capture-Western physical 20435896 , (Europe PMC )NA BioGRID UBE2M Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID UBE2S Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID UBE4B Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 14749733 , 18022694 , 19175675 , 20414249 , 21282470 , 26389662 , 27226613 , 28514442 , (Europe PMC )NA BioGRID UBE4B pull down direct interaction 26712280 , (Europe PMC )0.44 IntAct UBL4A Affinity Capture-MS, Affinity Capture-Western physical 21636303 , 23246001 , (Europe PMC )NA BioGRID UBL7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID UBOX5 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID UBQLN1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 19822669 , 23383273 , (Europe PMC )NA BioGRID UBR4 Affinity Capture-MS physical 23383273 , 23443559 , (Europe PMC )NA BioGRID UBR5 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID UBXN1 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation association, physical 15362974 , 18775313 , 21135095 , 25416956 , 26389662 , 27785701 , (Europe PMC )0.35 BioGRID, IntAct UBXN10 Affinity Capture-MS, Affinity Capture-Western physical 18775313 , 26389662 , (Europe PMC )NA BioGRID UBXN10 anti tag coimmunoprecipitation association 18775313 , (Europe PMC )0.35 IntAct UBXN11 Affinity Capture-Western physical 18775313 , (Europe PMC )NA BioGRID UBXN2A Affinity Capture-MS, Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 18775313 , 21900206 , 23443559 , 26389662 , 28514442 , (Europe PMC )0.62 BioGRID, IntAct, MINT UBXN2B Affinity Capture-MS, Reconstituted Complex, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 18775313 , 25416956 , 25775548 , 26186194 , 26389662 , 28514442 , (Europe PMC )0.49 BioGRID, IntAct UBXN4 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation association, physical, physical association 16968747 , 18775313 , 19822669 , 25078495 , 26389662 , (Europe PMC )0.50 BioGRID, IntAct UBXN6 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 16807242 , 18775313 , 19174149 , 19275885 , 21896481 , 21914798 , 22337587 , 22350894 , 23383273 , 25078495 , 26186194 , 26389662 , 26475856 , 27913212 , 28514442 , (Europe PMC )NA BioGRID UBXN6 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, molecular sieving, pull down, two hybrid association, direct interaction, physical association 18656546 , 18775313 , (Europe PMC )0.76 IntAct UBXN7 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Reconstituted Complex, anti tag coimmunoprecipitation, two hybrid array, two hybrid prey pooling approach association, physical, physical association 18775313 , 22466964 , 26389662 , 28274878 , (Europe PMC )0.75 BioGRID, IntAct UBXN8 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation association, physical 18775313 , 21949850 , 25078495 , 26389662 , (Europe PMC )0.35 BioGRID, IntAct UFD1 Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Reconstituted Complex physical 15371428 , 16234241 , 16822850 , 17872946 , 18199748 , 18775313 , 19275885 , 20414249 , 23333620 , 23443559 , 24248593 , 26389662 , 26549226 , 26712280 , 27226613 , 27913212 , (Europe PMC )NA BioGRID UFD1 anti tag coimmunoprecipitation, pull down, x-ray crystallography association, direct interaction 18775313 , 20414249 , 26712280 , (Europe PMC )0.74 IntAct, MINT ULK3 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID USP10 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID USP13 Affinity Capture-Western, Reconstituted Complex physical 24424410 , (Europe PMC )NA BioGRID VAPA Affinity Capture-Western physical 24885147 , (Europe PMC )NA BioGRID VAPB Affinity Capture-Western physical 24885147 , (Europe PMC )NA BioGRID VBP1 Affinity Capture-Western physical 23964080 , (Europe PMC )NA BioGRID VCAM1 Affinity Capture-MS, Affinity Capture-Western, cross-linking study association, physical 19738201 , 22623428 , 26337389 , (Europe PMC )0.35 BioGRID, IntAct VCL Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID VCP Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Reconstituted Complex, Two-hybrid, atomic force microscopy, electron tomography, ion mobility mass spectrometry of complexes, transmission electron microscopy, x-ray crystallography direct interaction, physical 10350210 , 12807884 , 16621797 , 17525332 , 18044963 , 20512113 , 22270372 , 23383273 , 24055316 , 25416956 , 26712278 , 26822609 , 26849035 , (Europe PMC )0.85 BioGRID, IntAct, MINT VCPIP1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 19615732 , 21811234 , 23500464 , 24163436 , 26389662 , (Europe PMC )0.40 BioGRID, IntAct VCPKMT Affinity Capture-MS, Biochemical Activity, Reconstituted Complex physical 23349634 , 28514442 , (Europe PMC )NA BioGRID VIL1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID VIM Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID VPS18 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct VPS50 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID VPS53 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID WAC Affinity Capture-Western, Reconstituted Complex physical 21811234 , (Europe PMC )NA BioGRID WAPL Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID WDR43 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID WDR82 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID WDYHV1 Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 25416956 , (Europe PMC )0.49 BioGRID, IntAct WNK1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID WRAP73 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct WRN Affinity Capture-Western, pull down physical, physical association 12937274 , 15037256 , (Europe PMC )0.40 BioGRID, IntAct WRNIP1 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID YAP1 Affinity Capture-MS physical 25796446 , (Europe PMC )NA BioGRID YOD1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 19818707 , 24417208 , 28244869 , (Europe PMC )0.49 BioGRID, IntAct YWHAB Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID YWHAE Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID YWHAG Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID YWHAH Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID YWHAQ Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID YWHAZ Affinity Capture-MS, Two-hybrid, pull down, two hybrid array physical, physical association 15161933 , 21988832 , 23383273 , (Europe PMC )0.57 BioGRID, IntAct, MINT ZFAND2B Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 24160817 , 26337389 , (Europe PMC )NA BioGRID ZFR Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ZNF326 Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID ZNF778 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
AKT1 S352_AATNRPNsIDPALRR , S746_AMRFARRsVSDNDIR , S748_RFARRSVsDNDIRKY , NA NA PhosphoSitePlus , ATM S326_EVERRIVsQLLTLMD , NA NA PhosphoSitePlus , ATR S784_NQGGAGPsQGSGGGT , NA NA PhosphoSitePlus , PRKDC S784_NQGGAGPsQGSGGGT , NA NA PhosphoSitePlus , Unknown S352_AATNRPNsIDPALRR , S3_MAsGADSKGD , S746_AMRFARRsVSDNDIR , S748_RFARRSVsDNDIRKY , S775_FGSFRFPsGNQGGAG , S784_NQGGAGPsQGSGGGT , S787_GAGPSQGsGGGTGGS , T436_LIDLEDEtIDAEVMN , T509_KFLKFGMtPSKGVLF , T613_TEMDGMStKKNVFII , Y805_EDNDDDLyG , HTP, LTP, in vivo 15592455 , 16027165 , 16140914 , 17525332 , 18077418 , 18691976 , 19664995 , 20068231 ,(Europe PMC )HPRD, PhosphoELM ,