Top
STK4
Gene Name STK4 (QuickGO )Interactive visualization of STK4 structures (A quick tutorial to explore the interactive visualization)Representative structure: 3COM
Synonyms STK4, KRS2, MST1 Protein Name STK4 Alternative Name(s) Serine/threonine-protein kinase 4;2.7.11.1;Mammalian STE20-like protein kinase 1;MST-1;STE20-like kinase MST1;Serine/threonine-protein kinase Krs-2;Serine/threonine-protein kinase 4 37kDa subunit;MST1/N;Serine/threonine-protein kinase 4 18kDa subunit;MST1/C; Protein Family Belongs to the protein kinase superfamily STE Ser/Thrprotein kinase family STE20 subfamily EntrezGene ID 6789    (Comparative Toxicogenomics) UniProt AC (Human) Q13043 (protein sequence )Enzyme Class 2.7.11.1 (BRENDA ) Molecular Weight 55630 Dalton Protein Length 487 amino acids (AA) Genome Browsers NCBI | ENSG00000101109 (Ensembl) | UCSC Crosslinking annotations Query our ID-mapping tableOrthologues Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG0201 | eggNOG - ENOG410XP9G Phosphorylation Network Visualize
Localization (UniProt annotation) Cytoplasm Nucleus Note=The caspase-cleavedform cycles between the nucleus and cytoplasm Function (UniProt annotation) Stress-activated, pro-apoptotic kinase which, followingcaspase-cleavage, enters the nucleus and induces chromatincondensation followed by internucleosomal DNA fragmentation Keycomponent of the Hippo signaling pathway which plays a pivotalrole in organ size control and tumor suppression by restrictingproliferation and promoting apoptosis The core of this pathway iscomposed of a kinase cascade wherein STK3/MST2 and STK4/MST1, incomplex with its regulatory protein SAV1, phosphorylates andactivates LATS1/2 in complex with its regulatory protein MOB1,which in turn phosphorylates and inactivates YAP1 oncoprotein andWWTR1/TAZ Phosphorylation of YAP1 by LATS2 inhibits itstranslocation into the nucleus to regulate cellular genesimportant for cell proliferation, cell death, and cell migrationSTK3/MST2 and STK4/MST1 are required to repress proliferation ofmature hepatocytes, to prevent activation of facultative adultliver stem cells (oval cells), and to inhibit tumor formation (Bysimilarity) Phosphorylates 'Ser-14' of histone H2B (H2BS14ph)during apoptosis Phosphorylates FOXO3 upon oxidative stress,which results in its nuclear translocation and cell deathinitiation Phosphorylates MOBKL1A, MOBKL1B and RASSF2Phosphorylates TNNI3 (cardiac Tn-I) and alters its bindingaffinity to TNNC1 (cardiac Tn-C) and TNNT2 (cardiac Tn-T)Phosphorylates FOXO1 on 'Ser-212' and regulates its activation andstimulates transcription of PMAIP1 in a FOXO1-dependent mannerPhosphorylates SIRT1 and inhibits SIRT1-mediated p53/TP53deacetylation, thereby promoting p53/TP53 dependent transcriptionand apoptosis upon DNA damage Acts as an inhibitor of PKB/AKT1Phosphorylates AR on 'Ser-650' and suppresses its activity byintersecting with PKB/AKT1 signaling and antagonizing formation ofAR-chromatin complexes Catalytic Activity (UniProt annotation) ATP + a protein = ADP + a phosphoprotein Protein Sequence METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIKEISIMQQC
DSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTE
GHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDVKLKRQESQQREVDQDDEENS
EEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFE
QKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF
STK4 is dephosphorylated by following phosphatases:
Phosphatase Gene Name Phosphatase UniProt_AC DephosphoSite and sequence (+/-5) in STK4 (Q13043) Bioassay Type PubMed ID View in Europe PMC Reliability of the interaction PHLPP1 O60346 Thr-387_KRRDEtMQPAK , In vitro and in vivo 20513427 , Europe PMC PHLPP2 Q6ZVD8 Thr-387_KRRDEtMQPAK , In vitro and in vivo 20513427 , Europe PMC PPP1CA P62136 Thr-183_MAKRNtVIGTP , In vitro 21199877 , Europe PMC PPP1CB P62140 Thr-183_MAKRNtVIGTP , In vitro 21199877 , Europe PMC PPP1CC P36873 Thr-183_MAKRNtVIGTP , In vitro 21199877 , Europe PMC PPP2CA P67775 Thr-183_MAKRNtVIGTP , In vitro 21199877 , Europe PMC PPP2CB P62714 Thr-183_MAKRNtVIGTP , In vitro 21199877 , Europe PMC
Pathway ID Pathway Name Pathway Description (KEGG) hsa04010 MAPK signaling pathway The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli. hsa04014 Ras signaling pathway The Ras proteins are GTPases that function as molecular switches for signaling pathways regulating cell proliferation, survival, growth, migration, differentiation or cytoskeletal dynamism. Ras proteins transduce signals from extracellular growth factors by cycling between inactive GDP-bound and active GTP-bound states. The exchange of GTP for GDP on RAS is regulated by guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs). Activated RAS (RAS-GTP) regulates multiple cellular functions through effectors including Raf, phosphatidylinositol 3-kinase (PI3K) and Ral guanine nucleotide-dissociation stimulator (RALGDS). hsa04068 FoxO signaling pathway The forkhead box O (FOXO) family of transcription factors regulates the expression of genes in cellular physiological events including apoptosis, cell-cycle control, glucose metabolism, oxidative stress resistance, and longevity. A central regulatory mechanism of FOXO proteins is phosphorylation by the serine-threonine kinase Akt/protein kinase B (Akt/PKB), downstream of phosphatidylinositol 3-kinase (PI3K), in response to insulin or several growth factors. Phosphorylation at three conserved residues results in the export of FOXO proteins from the nucleus to the cytoplasm, thereby decreasing expression of FOXO target genes. In contrast, the stress-activated c-Jun N-terminal kinase (JNK) and the energy sensing AMP-activated protein kinase (AMPK), upon oxidative and nutrient stress stimuli phosphorylate and activate FoxOs. Aside from PKB, JNK and AMPK, FOXOs are regulated by multiple players through several post-translational modifications, including phosphorylation, but also acetylation, methylation and ubiquitylation. hsa05200 Pathways in cancer hsa05223 Non-small cell lung cancer Lung cancer is a leading cause of cancer death among men and women in industrialized countries. Non-small-cell lung cancer (NSCLC) accounts for approximately 85% of lung cancer and represents a heterogeneous group of cancers, consisting mainly of squamous cell (SCC), adeno (AC) and large-cell carcinoma. Molecular mechanisms altered in NSCLC include activation of oncogenes, such as K-RAS, EGFR and EML4-ALK, and inactivation of tumorsuppressor genes, such as p53, p16INK4a, RAR-beta, and RASSF1. Point mutations within the K-RAS gene inactivate GTPase activity and the p21-RAS protein continuously transmits growth signals to the nucleus. Mutations or overexpression of EGFR leads to a proliferative advantage. EML4-ALK fusion leads to constitutive ALK activation, which causes cell proliferation, invasion, and inhibition of apoptosis. Inactivating mutation of p53 can lead to more rapid proliferation and reduced apoptosis. The protein encoded by the p16INK4a inhibits formation of CDK-cyclin-D complexes by competitive binding of CDK4 and CDK6. Loss of p16INK4a expression is a common feature of NSCLC. RAR-beta is a nuclear receptor that bears vitamin-A-dependent transcriptional activity. RASSF1A is able to form heterodimers with Nore-1, an RAS effector.Therefore loss of RASSF1A might shift the balance of RAS activity towards a growth-promoting effect.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-2028269 Signaling by Hippo. Human Hippo signaling is a network of reactions that regulates cell proliferation and apoptosis, centered on a three-step kinase cascade. The cascade was discovered by analysis of Drosophila mutations that lead to tissue overgrowth, and human homologues of its components have since been identified and characterized at a molecular level. Data from studies of mice carrying knockout mutant alleles of the genes as well as from studies of somatic mutations in these genes in human tumors are consistent with the conclusion that in mammals, as in flies, the Hippo cascade is required for normal regulation of cell proliferation and defects in the pathway are associated with cell overgrowth and tumorigenesis (Oh and Irvine 2010; Pan 2010; Zhao et al. 2010). This group of reactions is also notable for its abundance of protein:protein interactions mediated by WW domains and PPxY sequence motifs (Sudol and Harvey 2010).<p>There are two human homologues of each of the three Drosophila kinases, whose functions are well conserved: expression of human proteins rescues fly mutants. The two members of each pair of human homologues have biochemically indistinguishable functions. Autophosphorylated STK3 (MST2) and STK4 (MST1) (homologues of Drosophila Hippo) catalyze the phosphorylation and activation of LATS1 and LATS2 (homologues of Drosophila Warts) and of the accessory proteins MOB1A and MOB1B (homologues of Drosophila Mats). LATS1 and LATS2 in turn catalyze the phosphorylation of the transcriptional co-activators YAP1 and WWTR1 (TAZ) (homologues of Drosophila Yorkie).<p>In their unphosphorylated states, YAP1 and WWTR1 freely enter the nucleus and function as transcriptional co-activators. In their phosphorylated states, however, YAP1 and WWTR1 are instead bound by 14-3-3 proteins, YWHAB and YWHAE respectively, and sequestered in the cytosol.<p>Several accessory proteins are required for the three-step kinase cascade to function. STK3 (MST2) and STK4 (MST1) each form a complex with SAV1 (homologue of Drosophila Salvador), and LATS1 and LATS2 form complexes with MOB1A and MOB1B (homologues of Drosophila Mats).<p>In Drosophila a complex of three proteins, Kibra, Expanded, and Merlin, can trigger the Hippo cascade. A human homologue of Kibra, WWC1, has been identified and indirect evidence suggests that it can regulate the human Hippo pathway (Xiao et al. 2011). A molecular mechanism for this interaction has not yet been worked out and the molecular steps that trigger the Hippo kinase cascade in humans are unknown.<p>Four additional processes related to human Hippo signaling, although incompletely characterized, have been described in sufficient detail to allow their annotation. All are of physiological interest as they are likely to be parts of mechanisms by which Hippo signaling is modulated or functionally linked to other signaling processes. First, the caspase 3 protease cleaves STK3 (MST2) and STK4 (MST1), releasing inhibitory carboxyterminal domains in each case, leading to increased kinase activity and YAP1 / TAZ phosphorylation (Lee et al. 2001). Second, cytosolic AMOT (angiomotin) proteins can bind YAP1 and WWTR1 (TAZ) in their unphosphorylated states, a process that may provide a Hippo-independent mechanism to down-regulate the activities of these proteins (Chan et al. 2011). Third, WWTR1 (TAZ) and YAP1 bind ZO-1 and 2 proteins (Remue et al. 2010; Oka et al. 2010). Fourth, phosphorylated WWTR1 (TAZ) binds and sequesters DVL2, providing a molecular link between Hippo and Wnt signaling (Varelas et al. 2010)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABL1 Affinity Capture-Western, Biochemical Activity physical 21715626 , (Europe PMC )NA BioGRID ADCYAP1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID AKAP12 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct AKT1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy colocalization, direct interaction, physical, physical association 17932490 , 19940129 , (Europe PMC )0.62 BioGRID, IntAct, MINT ANXA1 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 23386615 , 24366813 , (Europe PMC )0.53 BioGRID, IntAct AURKB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct BTRC Affinity Capture-MS, Proximity Label-MS physical 25900982 , 28514442 , (Europe PMC )NA BioGRID CASP3 Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct CDC37 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct CDK3 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct CNKSR1 Affinity Capture-Western physical 15075335 , (Europe PMC )NA BioGRID CTTNBP2NL Affinity Capture-Western physical 24255178 , (Europe PMC )NA BioGRID CUL5 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID DAXX Reconstituted Complex physical 21572393 , (Europe PMC )NA BioGRID DYRK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID ERC1 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct FBXW11 Affinity Capture-MS, Affinity Capture-Western physical 25332235 , 25515538 , 25900982 , (Europe PMC )NA BioGRID FGFR1OP Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct FGFR1OP2 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct FOXO3 Affinity Capture-Western physical 21715626 , (Europe PMC )NA BioGRID H2AFX Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 20921231 , (Europe PMC )NA BioGRID HIST2H2BE Biochemical Activity physical 12757711 , 19940129 , 21572393 , (Europe PMC )NA BioGRID IL2RG Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct KIF2A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct KIF2B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID KIF2C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct KIF3B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KIF3C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct LATS2 Affinity Capture-MS, Biochemical Activity, FRET physical 24255178 , 26578655 , 26898830 , (Europe PMC )NA BioGRID MAP1B Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 20562859 , 23455922 , 24366813 , (Europe PMC )0.67 BioGRID, IntAct MAP1LC3A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical, physical association 20562859 , (Europe PMC )0.50 BioGRID, IntAct MAP1LC3B Affinity Capture-MS, anti tag coimmunoprecipitation, pull down association, direct interaction, physical, physical association 20562859 , (Europe PMC )0.63 BioGRID, IntAct MAP1S Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, tandem affinity purification association, colocalization, physical 23455922 , 24255178 , 24366813 , (Europe PMC )0.64 BioGRID, IntAct MOB1A Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, protein kinase assay, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, phosphorylation reaction, physical, physical association 21516123 , 23386615 , 24255178 , (Europe PMC )0.75 BioGRID, IntAct MOB1B Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, anti tag coimmunoprecipitation, protein kinase assay, proximity-dependent biotin identification association, colocalization, phosphorylation reaction, physical 22863277 , 24255178 , (Europe PMC )0.64 BioGRID, IntAct MOB4 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct NEDD4 Reconstituted Complex physical 19953087 , (Europe PMC )NA BioGRID RAB8A Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct RASSF1 Affinity Capture-MS, FRET, Proximity Label-MS, Two-hybrid physical 17598981 , 20562859 , 23455922 , 24255178 , 24366813 , 26186194 , 26578655 , 28514442 , (Europe PMC )NA BioGRID RASSF2 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, physical, physical association 20562859 , 20920251 , 23386615 , 23455922 , 24255178 , 24366813 , 26186194 , 28514442 , (Europe PMC )0.89 BioGRID, IntAct RASSF3 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, physical, physical association 20920251 , 23455922 , 24255178 , 24366813 , (Europe PMC )0.78 BioGRID, IntAct RASSF4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid association, physical, physical association 20562859 , 20920251 , 23455922 , 24366813 , (Europe PMC )0.79 BioGRID, IntAct RASSF5 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, coimmunoprecipitation, cross-linking study, molecular sieving, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid association, colocalization, direct interaction, physical, physical association 15109305 , 16892067 , 17517604 , 20562859 , 20920251 , 23455922 , 24255178 , 24366813 , (Europe PMC )0.37, 0.51, 0.58, 0.62, 0.81 BioGRID, IntAct RASSF6 Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 20920251 , 24366813 , 26186194 , 28514442 , (Europe PMC )0.63 BioGRID, IntAct S100A13 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SAV1 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, molecular sieving, nuclear magnetic resonance, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, direct interaction, physical, physical association 16930133 , 17517604 , 20562859 , 20920251 , 23386615 , 23455922 , 24255178 , 24366813 , 25692647 , 26186194 , 27173435 , 28514442 , (Europe PMC )0.56, 0.93 BioGRID, IntAct SGMS1 Biochemical Activity physical 22863277 , (Europe PMC )NA BioGRID SH3GLB2 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct SIRT1 Biochemical Activity physical 21212262 , (Europe PMC )NA BioGRID SLMAP Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, anti tag coimmunoprecipitation, confocal microscopy, proximity-dependent biotin identification, two hybrid association, colocalization, physical, physical association 23386615 , 24255178 , 24366813 , (Europe PMC )0.73 BioGRID, IntAct SLX4IP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 19596235 , (Europe PMC )0.35 BioGRID, IntAct SNX5 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct STK3 Affinity Capture-MS, Co-fractionation, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, physical, physical association 20562859 , 20920251 , 23386615 , 23455922 , 24255178 , 24366813 , 26344197 , (Europe PMC )0.87 BioGRID, IntAct STK4 Affinity Capture-Western, Biochemical Activity, FRET, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, coimmunoprecipitation, cross-linking study, light scattering, molecular sieving, nuclear magnetic resonance, two hybrid direct interaction, physical, physical association 17517604 , 20562859 , 21572393 , 22863277 , 23386615 , 26578655 , 8702870 , (Europe PMC )0.65, 0.69 BioGRID, IntAct STRIP1 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct STRN Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification association, colocalization, physical 24255178 , 24366813 , (Europe PMC )0.53 BioGRID, IntAct STRN3 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct STRN4 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct TAOK1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct THAP12 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 12384512 , 24255178 , (Europe PMC )NA BioGRID TP53 Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct VAPA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct VAPB Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID XPO1 Affinity Capture-MS, tandem affinity purification association, physical 23386615 , 26673895 , (Europe PMC )0.35 BioGRID, IntAct XPO6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct ZNF133 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF695 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACACA tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ACTBL2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct AKAP12 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct AKT1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy colocalization, direct interaction, physical, physical association 17932490 , 19940129 , (Europe PMC )0.62 BioGRID, IntAct, MINT ALB tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ANXA1 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 23386615 , 24366813 , (Europe PMC )0.53 BioGRID, IntAct ANXA2P2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ARF1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ARF4 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ARHGAP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ARHGAP18 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct AURKB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct AZGP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CALML5 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CAND1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CASP3 Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct CCT3 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CCT7 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CCT8 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CDC37 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct CDK3 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct CKAP5 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CLTC tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct COA1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct COPA tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct COPB1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct COPG1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CSE1L tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CSRP2 two hybrid physical association 23386615 , (Europe PMC )0.37 IntAct CTNNB1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct DDX3X tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct DDX5 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct DNAJA1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct DRG1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct DUSP9 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct DYRK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct EEF1A2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct EGLN3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct EIF3B tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct EIF3CL tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct EPPK1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ERC1 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct FEN1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct FGFR1OP Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct FGFR1OP2 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct FLG tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct FOXO1 protein kinase assay direct interaction 18786403 , (Europe PMC )0.44 IntAct GABARAP pull down direct interaction, physical association 20562859 , (Europe PMC )0.54 IntAct GABARAPL1 pull down direct interaction, physical association 20562859 , (Europe PMC )0.54 IntAct GABARAPL2 pull down direct interaction, physical association 20562859 , (Europe PMC )0.54 IntAct GAPDH tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct GGCT tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct GTF2I tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HAL tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HDLBP tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HIST1H1C tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSP90AA1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPA1L tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPA2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPA5 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPA6 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPA7 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPA8 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPA9 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPB1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HUWE1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IGHA1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IGLC1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IL2RG Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct ILK tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IPO4 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IPO5 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IPO7 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IQGAP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IQGAP2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct JCHAIN tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct KIF2A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct KIF2C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct KIF3B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KIF3C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KPNB1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct LATS1 fluorescence microscopy colocalization 24012335 , (Europe PMC )0.27 IntAct LCN1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct LTF tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MAP1B Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 20562859 , 23455922 , 24366813 , (Europe PMC )0.67 BioGRID, IntAct MAP1LC3A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical, physical association 20562859 , (Europe PMC )0.50 BioGRID, IntAct MAP1LC3B Affinity Capture-MS, anti tag coimmunoprecipitation, pull down association, direct interaction, physical, physical association 20562859 , (Europe PMC )0.63 BioGRID, IntAct MAP1LC3C pull down direct interaction 20562859 , (Europe PMC )0.44 IntAct MAP1S Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, tandem affinity purification association, colocalization, physical 23455922 , 24255178 , 24366813 , (Europe PMC )0.64 BioGRID, IntAct MAP2K4 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MCCC1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MCCC2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MCM3 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MCM4 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MCM7 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MOB1A Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, protein kinase assay, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, phosphorylation reaction, physical, physical association 21516123 , 23386615 , 24255178 , (Europe PMC )0.75 BioGRID, IntAct MOB1B Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, anti tag coimmunoprecipitation, protein kinase assay, proximity-dependent biotin identification association, colocalization, phosphorylation reaction, physical 22863277 , 24255178 , (Europe PMC )0.64 BioGRID, IntAct MOB4 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct MSH2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MSH6 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MTHFD1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct NCCRP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct NCL tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct NEURL4 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct PABPC1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct PAK3 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct PARP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct PARVB two hybrid physical association 23386615 , (Europe PMC )0.37 IntAct PHGDH tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct PIGR tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct PIH1D1 two hybrid physical association 23386615 , (Europe PMC )0.37 IntAct PKM protein kinase assay, tandem affinity purification association, phosphorylation reaction 23386615 , 24606918 , (Europe PMC )0.35, 0.44 IntAct PRDX1 anti tag coimmunoprecipitation, protein kinase assay, pull down, tandem affinity purification, two hybrid association, direct interaction, phosphorylation reaction, physical association 23386615 , (Europe PMC )0.66 IntAct PRDX2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct PTBP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct RAB8A Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct RANBP2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct RANGAP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct RASSF1 anti tag coimmunoprecipitation, coimmunoprecipitation, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, physical association 14729613 , 15109305 , 20562859 , 20920251 , 23386615 , 23455922 , 24255178 , 24366813 , (Europe PMC )0.73, 0.80 IntAct RASSF2 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, physical, physical association 20562859 , 20920251 , 23386615 , 23455922 , 24255178 , 24366813 , 26186194 , 28514442 , (Europe PMC )0.89 BioGRID, IntAct RASSF3 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, physical, physical association 20920251 , 23455922 , 24255178 , 24366813 , (Europe PMC )0.78 BioGRID, IntAct RASSF4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid association, physical, physical association 20562859 , 20920251 , 23455922 , 24366813 , (Europe PMC )0.79 BioGRID, IntAct RASSF5 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, coimmunoprecipitation, cross-linking study, molecular sieving, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid association, colocalization, direct interaction, physical, physical association 15109305 , 16892067 , 17517604 , 20562859 , 20920251 , 23455922 , 24255178 , 24366813 , (Europe PMC )0.37, 0.51, 0.58, 0.62, 0.81 BioGRID, IntAct RASSF6 Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 20920251 , 24366813 , 26186194 , 28514442 , (Europe PMC )0.63 BioGRID, IntAct RPL4 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct RPS18 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct RPS3 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct RPS4X tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct SAV1 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, molecular sieving, nuclear magnetic resonance, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, direct interaction, physical, physical association 16930133 , 17517604 , 20562859 , 20920251 , 23386615 , 23455922 , 24255178 , 24366813 , 25692647 , 26186194 , 27173435 , 28514442 , (Europe PMC )0.56, 0.93 BioGRID, IntAct SH3GLB2 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct SLMAP Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, anti tag coimmunoprecipitation, confocal microscopy, proximity-dependent biotin identification, two hybrid association, colocalization, physical, physical association 23386615 , 24255178 , 24366813 , (Europe PMC )0.73 BioGRID, IntAct SLX4IP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 19596235 , (Europe PMC )0.35 BioGRID, IntAct SMR3B tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct SNRNP200 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct SNX5 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct SOD2 two hybrid physical association 23386615 , (Europe PMC )0.37 IntAct SPATA5L1 two hybrid physical association 23386615 , (Europe PMC )0.37 IntAct SPTAN1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct SQSTM1 anti tag coimmunoprecipitation physical association 20562859 , (Europe PMC )0.40 IntAct SRP54 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct STAT1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct STAT3 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct STK3 Affinity Capture-MS, Co-fractionation, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, physical, physical association 20562859 , 20920251 , 23386615 , 23455922 , 24255178 , 24366813 , 26344197 , (Europe PMC )0.87 BioGRID, IntAct STK4 Affinity Capture-Western, Biochemical Activity, FRET, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, coimmunoprecipitation, cross-linking study, light scattering, molecular sieving, nuclear magnetic resonance, two hybrid direct interaction, physical, physical association 17517604 , 20562859 , 21572393 , 22863277 , 23386615 , 26578655 , 8702870 , (Europe PMC )0.65, 0.69 BioGRID, IntAct STRIP1 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct STRN Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification association, colocalization, physical 24255178 , 24366813 , (Europe PMC )0.53 BioGRID, IntAct STRN3 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct STRN4 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct SULT1A1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct TAOK1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct TCP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct TGM3 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct THAP12 anti tag coimmunoprecipitation association 24255178 , (Europe PMC )0.35 IntAct TP53 Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct TUBA1C tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct TUBA3C tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct TUBA4A tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct TUBB1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct TUBB4B tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct TUBB6 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct UBB two hybrid physical association 23386615 , (Europe PMC )0.37 IntAct VAPA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct XPO1 Affinity Capture-MS, tandem affinity purification association, physical 23386615 , 26673895 , (Europe PMC )0.35 BioGRID, IntAct XPO6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct XRCC5 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct XRCC6 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct YWHAG anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ZRSR2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AKT1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy colocalization, direct interaction, physical, physical association 17932490 , 19940129 , (Europe PMC )0.62 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABL1 Affinity Capture-Western, Biochemical Activity physical 21715626 , (Europe PMC )NA BioGRID ACACA tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ACTBL2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ADCYAP1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID AKAP12 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct AKT1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy colocalization, direct interaction, physical, physical association 17932490 , 19940129 , (Europe PMC )0.62 BioGRID, IntAct, MINT ALB tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ANXA1 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 23386615 , 24366813 , (Europe PMC )0.53 BioGRID, IntAct ANXA2P2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ARF1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ARF4 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ARHGAP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ARHGAP18 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct AURKB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct AZGP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct BTRC Affinity Capture-MS, Proximity Label-MS physical 25900982 , 28514442 , (Europe PMC )NA BioGRID CALML5 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CAND1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CASP3 Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct CCT3 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CCT7 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CCT8 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CDC37 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct CDK3 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct CKAP5 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CLTC tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CNKSR1 Affinity Capture-Western physical 15075335 , (Europe PMC )NA BioGRID COA1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct COPA tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct COPB1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct COPG1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CSE1L tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CSRP2 two hybrid physical association 23386615 , (Europe PMC )0.37 IntAct CTNNB1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct CTTNBP2NL Affinity Capture-Western physical 24255178 , (Europe PMC )NA BioGRID CUL5 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID DAXX Reconstituted Complex physical 21572393 , (Europe PMC )NA BioGRID DDX3X tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct DDX5 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct DNAJA1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct DRG1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct DUSP9 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct DYRK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct EEF1A2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct EGLN3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct EIF3B tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct EIF3CL tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ELAVL1 Affinity Capture-RNA physical 19322201 , (Europe PMC )NA BioGRID EPPK1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct ERC1 Affinity Capture-MS, tandem affinity purification association, physical 23455922 , (Europe PMC )0.35 BioGRID, IntAct FBXW11 Affinity Capture-MS, Affinity Capture-Western physical 25332235 , 25515538 , 25900982 , (Europe PMC )NA BioGRID FEN1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct FGFR1OP Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct FGFR1OP2 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct FLG tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct FOXO1 protein kinase assay direct interaction 18786403 , (Europe PMC )0.44 IntAct FOXO3 Affinity Capture-Western physical 21715626 , (Europe PMC )NA BioGRID GABARAP pull down direct interaction, physical association 20562859 , (Europe PMC )0.54 IntAct GABARAPL1 pull down direct interaction, physical association 20562859 , (Europe PMC )0.54 IntAct GABARAPL2 pull down direct interaction, physical association 20562859 , (Europe PMC )0.54 IntAct GAPDH tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct GGCT tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct GTF2I tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct H2AFX Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 20921231 , (Europe PMC )NA BioGRID HAL tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HDLBP tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HIST1H1C tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HIST2H2BE Biochemical Activity physical 12757711 , 19940129 , 21572393 , (Europe PMC )NA BioGRID HSP90AA1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPA1L tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPA2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPA5 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPA6 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPA7 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPA8 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPA9 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HSPB1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct HUWE1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IGHA1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IGLC1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IL2RG Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct ILK tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IPO4 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IPO5 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IPO7 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IQGAP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct IQGAP2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct JCHAIN tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct KIF2A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct KIF2B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID KIF2C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct KIF3B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KIF3C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KPNB1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct LATS1 fluorescence microscopy colocalization 24012335 , (Europe PMC )0.27 IntAct LATS2 Affinity Capture-MS, Biochemical Activity, FRET physical 24255178 , 26578655 , 26898830 , (Europe PMC )NA BioGRID LCN1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct LTF tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MAP1B Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 20562859 , 23455922 , 24366813 , (Europe PMC )0.67 BioGRID, IntAct MAP1LC3A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical, physical association 20562859 , (Europe PMC )0.50 BioGRID, IntAct MAP1LC3B Affinity Capture-MS, anti tag coimmunoprecipitation, pull down association, direct interaction, physical, physical association 20562859 , (Europe PMC )0.63 BioGRID, IntAct MAP1LC3C pull down direct interaction 20562859 , (Europe PMC )0.44 IntAct MAP1S Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, tandem affinity purification association, colocalization, physical 23455922 , 24255178 , 24366813 , (Europe PMC )0.64 BioGRID, IntAct MAP2K4 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MCCC1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MCCC2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MCM3 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MCM4 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MCM7 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MOB1A Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, protein kinase assay, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, phosphorylation reaction, physical, physical association 21516123 , 23386615 , 24255178 , (Europe PMC )0.75 BioGRID, IntAct MOB1B Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, anti tag coimmunoprecipitation, protein kinase assay, proximity-dependent biotin identification association, colocalization, phosphorylation reaction, physical 22863277 , 24255178 , (Europe PMC )0.64 BioGRID, IntAct MOB4 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct MSH2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MSH6 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct MTHFD1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct NCCRP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct NCL tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct NEDD4 Reconstituted Complex physical 19953087 , (Europe PMC )NA BioGRID NEURL4 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct PABPC1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct PAK3 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct PARP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct PARVB two hybrid physical association 23386615 , (Europe PMC )0.37 IntAct PHGDH tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct PIGR tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct PIH1D1 two hybrid physical association 23386615 , (Europe PMC )0.37 IntAct PKM protein kinase assay, tandem affinity purification association, phosphorylation reaction 23386615 , 24606918 , (Europe PMC )0.35, 0.44 IntAct PRDX1 anti tag coimmunoprecipitation, protein kinase assay, pull down, tandem affinity purification, two hybrid association, direct interaction, phosphorylation reaction, physical association 23386615 , (Europe PMC )0.66 IntAct PRDX2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct PTBP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct RAB8A Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct RANBP2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct RANGAP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct RASSF1 Affinity Capture-MS, FRET, Proximity Label-MS, Two-hybrid physical 17598981 , 20562859 , 23455922 , 24255178 , 24366813 , 26186194 , 26578655 , 28514442 , (Europe PMC )NA BioGRID RASSF1 anti tag coimmunoprecipitation, coimmunoprecipitation, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, physical association 14729613 , 15109305 , 20562859 , 20920251 , 23386615 , 23455922 , 24255178 , 24366813 , (Europe PMC )0.73, 0.80 IntAct RASSF2 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, physical, physical association 20562859 , 20920251 , 23386615 , 23455922 , 24255178 , 24366813 , 26186194 , 28514442 , (Europe PMC )0.89 BioGRID, IntAct RASSF3 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, physical, physical association 20920251 , 23455922 , 24255178 , 24366813 , (Europe PMC )0.78 BioGRID, IntAct RASSF4 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid association, physical, physical association 20562859 , 20920251 , 23455922 , 24366813 , (Europe PMC )0.79 BioGRID, IntAct RASSF5 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, coimmunoprecipitation, cross-linking study, molecular sieving, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid association, colocalization, direct interaction, physical, physical association 15109305 , 16892067 , 17517604 , 20562859 , 20920251 , 23455922 , 24255178 , 24366813 , (Europe PMC )0.37, 0.51, 0.58, 0.62, 0.81 BioGRID, IntAct RASSF6 Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 20920251 , 24366813 , 26186194 , 28514442 , (Europe PMC )0.63 BioGRID, IntAct RPL4 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct RPS18 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct RPS3 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct RPS4X tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct S100A13 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SAV1 Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, inference by socio-affinity scoring, molecular sieving, nuclear magnetic resonance, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, direct interaction, physical, physical association 16930133 , 17517604 , 20562859 , 20920251 , 23386615 , 23455922 , 24255178 , 24366813 , 25692647 , 26186194 , 27173435 , 28514442 , (Europe PMC )0.56, 0.93 BioGRID, IntAct SGMS1 Biochemical Activity physical 22863277 , (Europe PMC )NA BioGRID SH3GLB2 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct SIRT1 Biochemical Activity physical 21212262 , (Europe PMC )NA BioGRID SLMAP Affinity Capture-MS, Affinity Capture-Western, Proximity Label-MS, anti tag coimmunoprecipitation, confocal microscopy, proximity-dependent biotin identification, two hybrid association, colocalization, physical, physical association 23386615 , 24255178 , 24366813 , (Europe PMC )0.73 BioGRID, IntAct SLX4IP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 19596235 , (Europe PMC )0.35 BioGRID, IntAct SMR3B tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct SNRNP200 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct SNX5 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct SOD2 two hybrid physical association 23386615 , (Europe PMC )0.37 IntAct SPATA5L1 two hybrid physical association 23386615 , (Europe PMC )0.37 IntAct SPTAN1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct SQSTM1 anti tag coimmunoprecipitation physical association 20562859 , (Europe PMC )0.40 IntAct SRP54 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct STAT1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct STAT3 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct STK3 Affinity Capture-MS, Co-fractionation, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, tandem affinity purification, two hybrid association, colocalization, physical, physical association 20562859 , 20920251 , 23386615 , 23455922 , 24255178 , 24366813 , 26344197 , (Europe PMC )0.87 BioGRID, IntAct STK4 Affinity Capture-Western, Biochemical Activity, FRET, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, coimmunoprecipitation, cross-linking study, light scattering, molecular sieving, nuclear magnetic resonance, two hybrid direct interaction, physical, physical association 17517604 , 20562859 , 21572393 , 22863277 , 23386615 , 26578655 , 8702870 , (Europe PMC )0.65, 0.69 BioGRID, IntAct STRIP1 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct STRN Affinity Capture-MS, Proximity Label-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification association, colocalization, physical 24255178 , 24366813 , (Europe PMC )0.53 BioGRID, IntAct STRN3 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct STRN4 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct SULT1A1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct TAOK1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct TCP1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct TGM3 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct THAP12 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 12384512 , 24255178 , (Europe PMC )NA BioGRID THAP12 anti tag coimmunoprecipitation association 24255178 , (Europe PMC )0.35 IntAct TP53 Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct TUBA1C tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct TUBA3C tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct TUBA4A tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct TUBB1 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct TUBB4B tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct TUBB6 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct UBB two hybrid physical association 23386615 , (Europe PMC )0.37 IntAct VAPA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct VAPB Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID XPO1 Affinity Capture-MS, tandem affinity purification association, physical 23386615 , 26673895 , (Europe PMC )0.35 BioGRID, IntAct XPO6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct XRCC5 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct XRCC6 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct YWHAG anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ZNF133 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF695 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZRSR2 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
ABL1 Y433_KIPQDGDyEFLKSWT , NA NA PhosphoSitePlus , AKT1 T120_IIRLRNKtLTEDEIA , NA NA PhosphoSitePlus , CHEK1 T340_AVGDEMGtVRVASTM , NA NA PhosphoSitePlus , MAPK8 S82_SIMQQCDsPHVVKYY , NA NA PhosphoSitePlus , MST1 T183_DTMAKRNtVIGTPFW , LTP 11805089 ,(Europe PMC )PhosphoELM , STK4 S327_SEEDEMDsGTMVRAV , T177_VAGQLTDtMAKRNTV , T183_DTMAKRNtVIGTPFW , T187_KRNTVIGtPFWMAPE , T353_TMTDGANtMIEHDDT , T367_TLPSQLGtMVINAED , in vitro, in vivo 12223493 , 18452278 , 18691976 ,(Europe PMC )HPRD, PhosphoSitePlus , Unknown S265_VKQCLVKsPEQRATA , S320_DQDDEENsEEDEMDS , S410_EKENQINsFGKSVPG , S438_GDYEFLKsWTVEDLQ , T175_FGVAGQLtDTMAKRN , T238_RAIFMIPtNPPPTFR , T243_IPTNPPPtFRKPELW , T329_EDEMDSGtMVRAVGD , T340_AVGDEMGtVRVASTM , Y433_KIPQDGDyEFLKSWT , HTP, in vitro, in vivo 15345747 , 17192257 , 18212344 , 18452278 , 18669648 , 18691976 , 18707149 , 19415658 , 20068231 , 20166139 ,(Europe PMC )HPRD, PhosphoELM ,