Top
SRSF10
Gene Name SRSF10 (QuickGO )Interactive visualization of SRSF10 structures (A quick tutorial to explore the interactive visualization)Representative structure: NA
Synonyms SRSF10, FUSIP1, FUSIP2, SFRS13A, TASR Protein Name SRSF10 Alternative Name(s) Serine/arginine-rich splicing factor 10;40 kDa SR-repressor protein;SRrp40;FUS-interacting serine-arginine-rich protein 1;Splicing factor SRp38;Splicing factor, arginine/serine-rich 13A;TLS-associated protein with Ser-Arg repeats;TASR;TLS-associated protein with SR repeats;TLS-associated serine-arginine protein;TLS-associated SR protein; Protein Family Belongs to the splicing factor SR family EntrezGene ID 10772    (Comparative Toxicogenomics) UniProt AC (Human) O75494 (protein sequence )Enzyme Class N/A Molecular Weight 31301 Dalton Protein Length 262 amino acids (AA) Genome Browsers NCBI | ENSG00000188529 (Ensembl) | UCSC Crosslinking annotations Query our ID-mapping tableOrthologues Quest For Orthologues (QFO) | GeneTree | eggNOG - KOG0118 | eggNOG - COG0724 Phosphorylation Network Visualize
Localization (UniProt annotation) Nucleus speckleCytoplasm Function (UniProt annotation) Splicing factor that in its dephosphorylated form actsas a general repressor of pre-mRNA splicing (PubMed:11684676,PubMed:12419250, PubMed:14765198) Seems to interfere with the U1snRNP 5'-splice recognition of SNRNP70 (PubMed:14765198) Requiredfor splicing repression in M-phase cells and after heat shock(PubMed:14765198) Also acts as a splicing factor thatspecifically promotes exon skipping during alternative splicing(PubMed:26876937) Interaction with YTHDC1, a RNA-binding proteinthat recognizes and binds N6-methyladenosine (m6A)-containingRNAs, prevents SRSF10 from binding to its mRNA-binding sites closeto m6A-containing regions, leading to inhibit exon skipping duringalternative splicing (PubMed:26876937) May be involved inregulation of alternative splicing in neurons, with isoform 1acting as a positive and isoform 3 as a negative regulator(PubMed:12419250) Catalytic Activity (UniProt annotation) N/A Protein Sequence MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQ
IEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHS
DNDRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSR
SQSRSRSKSRSRSWTSPKSSGH
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
SRSF10 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa03040 Spliceosome After transcription, eukaryotic mRNA precursors contain protein-coding exons and noncoding introns. In the following splicing, introns are excised and exons are joined by a macromolecular complex, the spliceosome. The standard spliceosome is made up of five small nuclear ribonucleoproteins (snRNPs), U1, U2, U4, U5, and U6 snRNPs, and several spliceosome-associated proteins (SAPs). Spliceosomes are not a simple stable complex, but a dynamic family of particles that assemble on the mRNA precursor and help fold it into a conformation that allows transesterification to proceed. Various spliceosome forms (e.g. A-, B- and C-complexes) have been identified.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-72163 mRNA Splicing - Major Pathway. The splicing of pre-mRNA occurs within a large, very dynamic complex, designated the 'spliceosome'. The 50-60S spliceosomes are estimated to be 40-60 nm in diameter, and have molecular weights in the range of 3-5 million kDa. Small nuclear RNAs (snRNAs) U1, U2, U4, U5, and U6, are some of the best characterized components of spliceosomes, and are known to play key roles not only in spliceosomal assembly, but also in the two catalytic steps of the splicing reaction. Over 150 proteins have been detected in spliceosomes, and only a subset of these has been characterized. The characterization, and the determination of the functions of the protein components of the spliceosome, is still work in progress.<p>During spliceosome assembly, the snRNAs and the spliceosomal proteins assemble on the pre-mRNA in a stepwise pathway. First the E complex forms, followed by complexes A and B; the C complex forms next and contains the products of the first step of the splicing reaction. Complexes called i and D form as a consequence of the second step of the splicing reaction, which contain the excised intron and the spliced exons, respectively
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source APOBEC3D Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID B9D2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct BARD1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID BCAS2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID CAND1 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CBLL2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CEP164 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CLK2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CLK3 Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 28514442 , (Europe PMC )0.49 BioGRID, IntAct CSNK2A1 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 22113938 , (Europe PMC )0.44 BioGRID, IntAct CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID DHX15 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID EED Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID EIF4A3 Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation association, physical 22939629 , 23084401 , (Europe PMC )0.35 BioGRID, IntAct ELAVL2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID EPRS Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID EZH2 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID FUS Affinity Capture-Western, Two-hybrid, beta lactamase complementation physical, physical association 10779324 , 9774382 , (Europe PMC )0.37 BioGRID, IntAct, MINT HECW2 Affinity Capture-MS physical 24163370 , (Europe PMC )NA BioGRID HNRNPD Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct IK Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID LUC7L Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LUC7L2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LUZP4 Affinity Capture-MS physical 25662211 , (Europe PMC )NA BioGRID MAGOH Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23084401 , (Europe PMC )0.35 BioGRID, IntAct MSH2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID MZT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NCSTN Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID NFIA Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID NKAPD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID PAXIP1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PHGDH Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PNN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PRKDC Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PTPN11 Two-hybrid physical 27229929 , (Europe PMC )NA BioGRID RBM14 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RNF2 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID RPL6 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID RPSA Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID S100A9 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SAP18 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SEPT2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SGTB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SLAIN2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SMU1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SNIP1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SNRNP70 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SNU13 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SREK1 Affinity Capture-MS physical 14559993 , 26186194 , 28514442 , (Europe PMC )NA BioGRID SRSF1 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT SRSF4 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT SRSF6 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID STAU1 Affinity Capture-MS physical 23125841 , (Europe PMC )NA BioGRID SUZ12 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID TCERG1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TCOF1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID THOC6 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TRA2A Affinity Capture-MS, Co-fractionation physical 22939629 , 26186194 , 28514442 , (Europe PMC )NA BioGRID TRA2B Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT TRIM55 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TRMT112 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TUBGCP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct U2AF2 Affinity Capture-MS, Affinity Capture-Western physical 26641092 , 28514442 , (Europe PMC )NA BioGRID USP39 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID UTP14A Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID VASN Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID VTN Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID WWOX Affinity Capture-MS physical 24550385 , (Europe PMC )NA BioGRID YWHAB Affinity Capture-MS, coimmunoprecipitation physical, physical association 15324660 , (Europe PMC )0.40 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, anti bait coimmunoprecipitation, coimmunoprecipitation physical, physical association 15324660 , 17353931 , (Europe PMC )0.59 BioGRID, IntAct, MINT YWHAQ Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct ZC3H18 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 28514442 , 29298432 , (Europe PMC )0.35 BioGRID, IntAct ZMYND11 Affinity Capture-MS physical 25263594 , (Europe PMC )NA BioGRID ZNF687 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AGO1 anti tag coimmunoprecipitation association 17932509 , (Europe PMC )0.35 IntAct, MINT B9D2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CEP164 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CLK3 Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 28514442 , (Europe PMC )0.49 BioGRID, IntAct CSNK2A1 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 22113938 , (Europe PMC )0.44 BioGRID, IntAct DAPK1 protein array direct interaction 29513927 , (Europe PMC )0.44 IntAct DDX41 anti tag coimmunoprecipitation association 25920683 , (Europe PMC )0.35 IntAct EIF4A3 Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation association, physical 22939629 , 23084401 , (Europe PMC )0.35 BioGRID, IntAct FUS Affinity Capture-Western, Two-hybrid, beta lactamase complementation physical, physical association 10779324 , 9774382 , (Europe PMC )0.37 BioGRID, IntAct, MINT GABARAP anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GABARAPL2 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GRB2 pull down association 12577067 , (Europe PMC )0.35 IntAct HNRNPD Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HSCB anti bait coimmunoprecipitation association 28380382 , (Europe PMC )0.35 IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT MAGOH Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23084401 , (Europe PMC )0.35 BioGRID, IntAct MAP1LC3A anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct MZT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SGTB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SLAIN2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SRPK1 protein kinase assay phosphorylation reaction 23602568 , (Europe PMC )0.44 IntAct SRPK2 protein kinase assay phosphorylation reaction 23602568 , (Europe PMC )0.44 IntAct SRSF1 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT SRSF4 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT TRA2B Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT TUBGCP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct YWHAB Affinity Capture-MS, coimmunoprecipitation physical, physical association 15324660 , (Europe PMC )0.40 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, anti bait coimmunoprecipitation, coimmunoprecipitation physical, physical association 15324660 , 17353931 , (Europe PMC )0.59 BioGRID, IntAct, MINT YWHAQ Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct ZC3H18 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 28514442 , 29298432 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AGO1 anti tag coimmunoprecipitation association 17932509 , (Europe PMC )0.35 IntAct, MINT FUS Affinity Capture-Western, Two-hybrid, beta lactamase complementation physical, physical association 10779324 , 9774382 , (Europe PMC )0.37 BioGRID, IntAct, MINT JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SRSF1 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT SRSF4 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT TRA2B Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT YWHAB Affinity Capture-MS, coimmunoprecipitation physical, physical association 15324660 , (Europe PMC )0.40 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, anti bait coimmunoprecipitation, coimmunoprecipitation physical, physical association 15324660 , 17353931 , (Europe PMC )0.59 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AGO1 anti tag coimmunoprecipitation association 17932509 , (Europe PMC )0.35 IntAct, MINT APOBEC3D Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID B9D2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct BARD1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID BCAS2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID CAND1 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CBLL2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CEP164 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CLK2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CLK3 Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 28514442 , (Europe PMC )0.49 BioGRID, IntAct CSNK2A1 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 22113938 , (Europe PMC )0.44 BioGRID, IntAct CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID DAPK1 protein array direct interaction 29513927 , (Europe PMC )0.44 IntAct DDX41 anti tag coimmunoprecipitation association 25920683 , (Europe PMC )0.35 IntAct DHX15 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID EED Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID EIF4A3 Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation association, physical 22939629 , 23084401 , (Europe PMC )0.35 BioGRID, IntAct ELAVL2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID EPRS Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID EZH2 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID FUS Affinity Capture-Western, Two-hybrid, beta lactamase complementation physical, physical association 10779324 , 9774382 , (Europe PMC )0.37 BioGRID, IntAct, MINT GABARAP anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GABARAPL2 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GRB2 pull down association 12577067 , (Europe PMC )0.35 IntAct HECW2 Affinity Capture-MS physical 24163370 , (Europe PMC )NA BioGRID HNRNPD Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HSCB anti bait coimmunoprecipitation association 28380382 , (Europe PMC )0.35 IntAct IK Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LUC7L Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LUC7L2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LUZP4 Affinity Capture-MS physical 25662211 , (Europe PMC )NA BioGRID MAGOH Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23084401 , (Europe PMC )0.35 BioGRID, IntAct MAP1LC3A anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct MSH2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID MZT1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NCSTN Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID NFIA Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID NKAPD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID PAXIP1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID PHGDH Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PNN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PRKDC Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PTPN11 Two-hybrid physical 27229929 , (Europe PMC )NA BioGRID RBM14 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RNF2 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID RPL6 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID RPSA Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID S100A9 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SAP18 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SEPT2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SGTB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SLAIN2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SMU1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SNIP1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SNRNP70 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SNU13 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SREK1 Affinity Capture-MS physical 14559993 , 26186194 , 28514442 , (Europe PMC )NA BioGRID SRPK1 protein kinase assay phosphorylation reaction 23602568 , (Europe PMC )0.44 IntAct SRPK2 protein kinase assay phosphorylation reaction 23602568 , (Europe PMC )0.44 IntAct SRSF1 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT SRSF4 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT SRSF6 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID STAU1 Affinity Capture-MS physical 23125841 , (Europe PMC )NA BioGRID SUZ12 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID TCERG1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TCOF1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID THOC6 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TRA2A Affinity Capture-MS, Co-fractionation physical 22939629 , 26186194 , 28514442 , (Europe PMC )NA BioGRID TRA2B Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT TRIM55 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TRMT112 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TUBGCP2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct U2AF2 Affinity Capture-MS, Affinity Capture-Western physical 26641092 , 28514442 , (Europe PMC )NA BioGRID USP39 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID UTP14A Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID VASN Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID VTN Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID WWOX Affinity Capture-MS physical 24550385 , (Europe PMC )NA BioGRID YWHAB Affinity Capture-MS, coimmunoprecipitation physical, physical association 15324660 , (Europe PMC )0.40 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, anti bait coimmunoprecipitation, coimmunoprecipitation physical, physical association 15324660 , 17353931 , (Europe PMC )0.59 BioGRID, IntAct, MINT YWHAQ Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct ZC3H18 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 28514442 , 29298432 , (Europe PMC )0.35 BioGRID, IntAct ZMYND11 Affinity Capture-MS physical 25263594 , (Europe PMC )NA BioGRID ZNF687 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
Unknown S106_KEGRNVYsSSRYDDY , S107_EGRNVYSsSRYDDYD , S108_GRNVYSSsRYDDYDR , S119_DYDRYRRsRSRSYER , S121_DRYRRSRsRSYERRR , S123_YRRSRSRsYERRRSR , S129_RSYERRRsRSRSFDY , S131_YERRRSRsRSFDYNY , S133_RRRSRSRsFDYNYRR , S141_FDYNYRRsYSPRNSR , S143_YNYRRSYsPRNSRPT , S156_PTGRPRRsRSHSDND , S158_GRPRRSRsHSDNDRF , S160_PRRSRSHsDNDRFKH , S235_RKKEPPRsKSQSRSQ , S249_QSRSRSKsRSRSWTS , S251_RSRSKSRsRSWTSPK , S253_RSKSRSRsWTSPKSS , S256_SRSRSWTsPKSSGH , S259_RSWTSPKsSGH , T255_KSRSRSWtSPKSSGH , Y105_AKEGRNVySSSRYDD , Y110_NVYSSSRyDDYDRYR , Y136_SRSRSFDyNYRRSYS , Y138_SRSFDYNyRRSYSPR , HTP, in vivo 15302935 , 17081983 , 17287340 , 17322306 , 18212344 , 18220336 , 18452278 , 18669648 , 18691976 , 18767875 , 19413330 , 19415658 , 19651622 , 19664994 , 19664995 , 20058876 , 20068231 , 20166139 ,(Europe PMC )HPRD, PhosphoELM ,