Top
RACGAP1
Localization (UniProt annotation) Nucleus Cytoplasm Cytoplasm, cytoskeleton,spindle Cytoplasmic vesicle, secretory vesicle, acrosomeCleavage furrow Midbody, Midbody ring Cell membrane; Peripheral membraneprotein; Cytoplasmic side Note=Colocalizes with RND2 in Golgi-derived proacrosomal vesicles and the acrosome (By similarity)During interphase, localized to the nucleus and cytoplasm alongwith microtubules, in anaphase, is redistributed to the centralspindle and, in telophase and cytokinesis, to the midbody ring,also called Flemming body Colocalizes with RHOA at the myosincontractile ring during cytokinesis Colocalizes with ECT2 to themitotic spindles during anaphase/metaphase, the cleavage furrowduring telophase and at the midbody at the end of cytokinesisColocalizes with Cdc42 to spindle microtubules from prometaphaseto telophase Function (UniProt annotation) Component of the centralspindlin complex that serves asa microtubule-dependent and Rho-mediated signaling required forthe myosin contractile ring formation during the cell cyclecytokinesis Required for proper attachment of the midbody to thecell membrane during cytokinesis Plays key roles in controllingcell growth and differentiation of hematopoietic cells throughmechanisms other than regulating Rac GTPase activity Alsoinvolved in the regulation of growth-related processes inadipocytes and myoblasts May be involved in regulatingspermatogenesis and in the RACGAP1 pathway in neuronalproliferation Shows strong GAP (GTPase activation) activitytowards CDC42 and RAC1 and less towards RHOA Essential for theearly stages of embryogenesis May play a role in regulatingcortical activity through RHOA during cytokinesis May participatein the regulation of sulfate transport in male germ cells Catalytic Activity (UniProt annotation) N/A Protein Sequence MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVD
VEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEEQKSALAFLNRGQPSSSNAGNKRLSTIDESGSILSDISFDK
TDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQGNESIVAKTTVTVPNDGGPIEAVSTIETVP
YWTRSRRKTGTLQPWNSDSTLNSRQLEPRTETDSVGTPQSNGGMRLHDFVSKTVIKPESCVPCGKRIKFGKLSLKCRDCR
VVSHPECRDRCPLPCIPTLIGTPVKIGEGMLADFVSQTSPMIPSIVVHCVNEIEQRGLTETGLYRISGCDRTVKELKEKF
LRVKTVPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQANRDTLAFLMIHL
QRVAQSPHTKMDVANLAKVFGPTIVAHAVPNPDPVTMLQDIKRQPKVVERLLSLPLEYWSQFMMVEQENIDPLHVIENSN
AFSTPQTPDIKVSLLGPVTTPEHQLLKTPSSSSLSQRVRSTLTKNTPRFGSKSKSATNLGRQGNFFASPMLK
RACGAP1 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-194840 Rho GTPase cycle. The cycling of Rho GTPases is tightly controlled by three classes of protein. These are (1) guanine nucleotide dissociation inhibitors or GDIs, which maintain Rho proteins in an inactive state in the cytoplasm, (2) guanine nucleotide exchange factors or GEFs, which destabilize the interaction between Rho proteins and their bound nucleotide, the net result of which is the exchange of bound GDP for the more abundant GTP, and (3) GTPase Activating Proteins or GAPs, which stimulate the low intrinsic GTP hydrolysis activity of Rho family members, thus promoting their inactivation. GDIs, GEFs, and GAPs are themselves subject to tight regulation, and the overall level of Rho activity reflects the balance of their activities.<p>In their active GTP-bound state, Rho family members have the ability to interact with a large variety of so-called effector proteins. By changing the subcellular localization of effectors, by altering their enzymatic properties, or by directing the formation of specific effector complexes, members of the Rho family mediate their various effects.<p>This Rho GTPase cycle is diagrammed in the figure below. External or internal cues promote the release of Rho GTPases from the inhibitory complex (1) which allows them to associate with the plasma membrane (2) where they are activated by GEFs (3) and can signal to effector proteins. Then, GAPs inactivate the GTPases by accelerating the intrinsic GTPase activity, leading to the GDP bound form (4). Once again, the GDI molecules stabilize the inactive GDP bound form in the cytoplasm, waiting for further instructions (5). (Figure and text from Tcherkezian and Lamarche Vane, 2007) R-HSA-2132295 MHC class II antigen presentation. Antigen presenting cells (APCs) such as B cells, dendritic cells (DCs) and monocytes/macrophages express major histocompatibility complex class II molecules (MHC II) at their surface and present exogenous antigenic peptides to CD4+ T helper cells. CD4+ T cells play a central role in immune protection. On their activation they stimulate differentiation of B cells into antibody-producing B-cell blasts and initiate adaptive immune responses. MHC class II molecules are transmembrane glycoprotein heterodimers of alpha and beta subunits. Newly synthesized MHC II molecules present in the endoplasmic reticulum bind to a chaperone protein called invariant (Ii) chain. The binding of Ii prevents the premature binding of self antigens to the nascent MHC molecules in the ER and also guides MHC molecules to endocytic compartments. In the acidic endosomal environment, Ii is degraded in a stepwise manner, ultimately to free the class II peptide-binding groove for loading of antigenic peptides. Exogenous antigens are internalized by the APC by receptor mediated endocytosis, phagocytosis or pinocytosis into endocytic compartments of MHC class II positive cells, where engulfed antigens are degraded in a low pH environment by multiple acidic proteases, generating MHC class II epitopes. Antigenic peptides are then loaded into the class II ligand-binding groove. The resulting class II peptide complexes then move to the cell surface, where they are scanned by CD4+ T cells for specific recognition (Berger & Roche 2009, Zhou & Blum 2004, Watts 2004, Landsverk et al. 2009) R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic. Retrograde traffic from the cis-Golgi to the ERGIC or the ER is mediated in part by microtubule-directed COPI-coated vesicles (Letourneur et al, 1994; Shima et al, 1999; Spang et al, 1998; reviewed in Lord et al, 2013; Spang et al, 2013). These assemble at the cis side of the Golgi in a GBF-dependent fashion and are tethered at the ER by the ER-specific SNAREs and by the conserved NRZ multisubunit tethering complex, known as DSL in yeast (reviewed in Tagaya et al, 2014; Hong and Lev, 2014). Typical cargo of these retrograde vesicles includes 'escaped' ER chaperone proteins, which are recycled back to the ER for reuse by virtue of their interaction with the Golgi localized KDEL receptors (reviewed in Capitani and Sallese, 2009; Cancino et al, 2013) R-HSA-983189 Kinesins. Kinesins are a superfamily of microtubule-based motor proteins that have diverse functions in transport of vesicles, organelles and chromosomes, and regulate microtubule dynamics. There are 14 families of kinesins, all reprsented in humans. A standardized nomenclature was published in 2004 (Lawrence et al.)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTL8 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AKT2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ANKRD11 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARID5B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AURKB Biochemical Activity, protein kinase assay phosphorylation reaction, physical 12689593 , 18201571 , (Europe PMC )0.44 BioGRID, IntAct, MINT BAZ2A Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID BCL7B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct C2CD5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAPZA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CD2AP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct CDC5L Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT CDK1 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 18201571 , (Europe PMC )0.44 BioGRID, IntAct, MINT CHD6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHEK1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CSTF1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CUL1 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID DAPK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DLG3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ECT2 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, isothermal titration calorimetry, pull down, two hybrid association, direct interaction, physical, physical association 18201571 , 19468300 , 19468302 , 22750944 , 25068414 , (Europe PMC )0.40, 0.88 BioGRID, IntAct, MINT ENTPD6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct EOGT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ERC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FAM98A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FOXA1 Affinity Capture-MS physical 27926873 , (Europe PMC )NA BioGRID FZR1 Affinity Capture-Western physical 23696789 , (Europe PMC )NA BioGRID G3BP1 Affinity Capture-MS physical 26777405 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-MS, pull down association, physical 12577067 , (Europe PMC )0.35 BioGRID, IntAct HIST1H2BG Proximity Label-MS physical 25281560 , (Europe PMC )NA BioGRID HMGA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HSD17B4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct IFI16 Affinity Capture-MS physical 25693804 , (Europe PMC )NA BioGRID IKBKG Affinity Capture-Western physical 18511905 , (Europe PMC )NA BioGRID IPP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KIF23 Affinity Capture-MS, Co-fractionation, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, fluorescence microscopy, pull down, two hybrid association, colocalization, physical, physical association 11782313 , 18201571 , 22580824 , 22939629 , 26344197 , 26496610 , 28514442 , (Europe PMC )0.35, 0.82 BioGRID, IntAct, MINT KLHL8 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LDHD Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID LIG3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MED21 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MICAL3 Affinity Capture-MS, anti tag coimmunoprecipitation, pull down association, physical 26496610 , 27528609 , (Europe PMC )0.35 BioGRID, IntAct MORF4L1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct MPG Affinity Capture-MS physical 23537643 , (Europe PMC )NA BioGRID MPRIP Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MRPL35 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PCNT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PHLDB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PKP4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP1CB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PRSS23 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PSMD1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PTPA Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 18201571 , (Europe PMC )NA BioGRID RABL6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RAPGEF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RASIP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RCC2 Affinity Capture-MS physical 25074804 , (Europe PMC )NA BioGRID RFC1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RND2 Affinity Capture-Western, Reconstituted Complex physical 12590651 , (Europe PMC )NA BioGRID ROCK2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RPGRIP1L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct RSRC1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID SAMHD1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SH3KBP1 Affinity Capture-MS physical 19531213 , (Europe PMC )NA BioGRID SHCBP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct SLC26A8 Reconstituted Complex, Two-hybrid physical 11278976 , (Europe PMC )NA BioGRID SMNDC1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SNW1 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT STON2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STX18 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID SYBU Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYNCRIP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TANK Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct TCTN3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TNFRSF8 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRAPPC11 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TRIM27 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TXNDC11 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct VAV1 Reconstituted Complex physical 10748082 , (Europe PMC )NA BioGRID VRK1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID WDR5 Affinity Capture-Western physical 25666610 , (Europe PMC )NA BioGRID YWHAB Affinity Capture-MS, anti bait coimmunoprecipitation, coimmunoprecipitation physical, physical association 15324660 , 17353931 , (Europe PMC )0.59 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 15324660 , 17353931 , 26496610 , (Europe PMC )0.69 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTL8 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AKT2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ANKRD11 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARF6 pull down association 22580824 , (Europe PMC )0.35 IntAct, MINT ARID5B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AURKB Biochemical Activity, protein kinase assay phosphorylation reaction, physical 12689593 , 18201571 , (Europe PMC )0.44 BioGRID, IntAct, MINT BCL7B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct C2CD5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAPZA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CD2AP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct CDC5L Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT CDH1 anti bait coimmunoprecipitation association 22750944 , (Europe PMC )0.35 IntAct CDK1 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 18201571 , (Europe PMC )0.44 BioGRID, IntAct, MINT CHD6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CTNNA1 anti bait coimmunoprecipitation association, physical association 22750944 , (Europe PMC )0.50 IntAct DAPK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DLG3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ECT2 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, isothermal titration calorimetry, pull down, two hybrid association, direct interaction, physical, physical association 18201571 , 19468300 , 19468302 , 22750944 , 25068414 , (Europe PMC )0.40, 0.88 BioGRID, IntAct, MINT EGLN3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ENTPD6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct EOGT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ERC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct GRB2 Affinity Capture-MS, pull down association, physical 12577067 , (Europe PMC )0.35 BioGRID, IntAct HIST1H3A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct HMGA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HSD17B4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct IPP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KIF23 Affinity Capture-MS, Co-fractionation, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, fluorescence microscopy, pull down, two hybrid association, colocalization, physical, physical association 11782313 , 18201571 , 22580824 , 22939629 , 26344197 , 26496610 , 28514442 , (Europe PMC )0.35, 0.82 BioGRID, IntAct, MINT LDHD anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct LMNA proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MED21 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MICAL3 Affinity Capture-MS, anti tag coimmunoprecipitation, pull down association, physical 26496610 , 27528609 , (Europe PMC )0.35 BioGRID, IntAct MORF4L1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct MPRIP Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MRPL35 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PCNT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PHLDB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PKP4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PLK1 anti bait coimmunoprecipitation, far western blotting, protein kinase assay association, direct interaction, phosphorylation reaction 19468300 , 19468302 , (Europe PMC )0.71 IntAct PPP1CB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP2CA phosphatase assay dephosphorylation reaction 18201571 , (Europe PMC )0.44 IntAct, MINT PPP2R5E anti tag coimmunoprecipitation, far western blotting, two hybrid direct interaction, physical association 18201571 , (Europe PMC )0.59 IntAct, MINT PRSS23 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct RAB11FIP3 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, competition binding, fluorescence microscopy, pull down association, colocalization, direct interaction, physical association 18511905 , (Europe PMC )0.65 IntAct, MINT RAB11FIP4 pull down direct interaction 18511905 , (Europe PMC )0.44 IntAct, MINT RABL6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RAPGEF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RASIP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RPGRIP1L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct SAMHD1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SHCBP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct SLC26A8 pull down, two hybrid physical association 11278976 , (Europe PMC )0.51 IntAct SNW1 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT STON2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYBU Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYNCRIP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TANK Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct TCTN3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TRAPPC11 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TRIM27 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TXNDC11 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct YWHAB Affinity Capture-MS, anti bait coimmunoprecipitation, coimmunoprecipitation physical, physical association 15324660 , 17353931 , (Europe PMC )0.59 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 15324660 , 17353931 , 26496610 , (Europe PMC )0.69 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ARF6 pull down association 22580824 , (Europe PMC )0.35 IntAct, MINT AURKB Biochemical Activity, protein kinase assay phosphorylation reaction, physical 12689593 , 18201571 , (Europe PMC )0.44 BioGRID, IntAct, MINT CDC5L Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT CDK1 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 18201571 , (Europe PMC )0.44 BioGRID, IntAct, MINT ECT2 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, isothermal titration calorimetry, pull down, two hybrid association, direct interaction, physical, physical association 18201571 , 19468300 , 19468302 , 22750944 , 25068414 , (Europe PMC )0.40, 0.88 BioGRID, IntAct, MINT KIF23 Affinity Capture-MS, Co-fractionation, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, fluorescence microscopy, pull down, two hybrid association, colocalization, physical, physical association 11782313 , 18201571 , 22580824 , 22939629 , 26344197 , 26496610 , 28514442 , (Europe PMC )0.35, 0.82 BioGRID, IntAct, MINT PPP2CA phosphatase assay dephosphorylation reaction 18201571 , (Europe PMC )0.44 IntAct, MINT PPP2R5E anti tag coimmunoprecipitation, far western blotting, two hybrid direct interaction, physical association 18201571 , (Europe PMC )0.59 IntAct, MINT RAB11FIP3 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, competition binding, fluorescence microscopy, pull down association, colocalization, direct interaction, physical association 18511905 , (Europe PMC )0.65 IntAct, MINT RAB11FIP4 pull down direct interaction 18511905 , (Europe PMC )0.44 IntAct, MINT SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SNW1 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT YWHAB Affinity Capture-MS, anti bait coimmunoprecipitation, coimmunoprecipitation physical, physical association 15324660 , 17353931 , (Europe PMC )0.59 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 15324660 , 17353931 , 26496610 , (Europe PMC )0.69 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTL8 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AKT2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ANKRD11 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARF6 pull down association 22580824 , (Europe PMC )0.35 IntAct, MINT ARID5B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct AURKB Biochemical Activity, protein kinase assay phosphorylation reaction, physical 12689593 , 18201571 , (Europe PMC )0.44 BioGRID, IntAct, MINT BAZ2A Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID BCL7B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct C2CD5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAPZA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CD2AP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct CDC5L Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT CDH1 anti bait coimmunoprecipitation association 22750944 , (Europe PMC )0.35 IntAct CDK1 Biochemical Activity, protein kinase assay phosphorylation reaction, physical 18201571 , (Europe PMC )0.44 BioGRID, IntAct, MINT CHD6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CHEK1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CSTF1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CTNNA1 anti bait coimmunoprecipitation association, physical association 22750944 , (Europe PMC )0.50 IntAct CUL1 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID DAPK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DLG3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ECT2 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, isothermal titration calorimetry, pull down, two hybrid association, direct interaction, physical, physical association 18201571 , 19468300 , 19468302 , 22750944 , 25068414 , (Europe PMC )0.40, 0.88 BioGRID, IntAct, MINT EGLN3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct ENTPD6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct EOGT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ERC1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FAM98A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FOXA1 Affinity Capture-MS physical 27926873 , (Europe PMC )NA BioGRID FZR1 Affinity Capture-Western physical 23696789 , (Europe PMC )NA BioGRID G3BP1 Affinity Capture-MS physical 26777405 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-MS, pull down association, physical 12577067 , (Europe PMC )0.35 BioGRID, IntAct HIST1H2BG Proximity Label-MS physical 25281560 , (Europe PMC )NA BioGRID HIST1H3A proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct HMGA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct HSD17B4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct IFI16 Affinity Capture-MS physical 25693804 , (Europe PMC )NA BioGRID IKBKG Affinity Capture-Western physical 18511905 , (Europe PMC )NA BioGRID IPP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KIF23 Affinity Capture-MS, Co-fractionation, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, cosedimentation through density gradient, fluorescence microscopy, pull down, two hybrid association, colocalization, physical, physical association 11782313 , 18201571 , 22580824 , 22939629 , 26344197 , 26496610 , 28514442 , (Europe PMC )0.35, 0.82 BioGRID, IntAct, MINT KLHL8 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LDHD Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID LDHD anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct LIG3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID LMNA proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct MED21 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MICAL3 Affinity Capture-MS, anti tag coimmunoprecipitation, pull down association, physical 26496610 , 27528609 , (Europe PMC )0.35 BioGRID, IntAct MORF4L1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct MPG Affinity Capture-MS physical 23537643 , (Europe PMC )NA BioGRID MPRIP Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MRPL35 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PCNT Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PHLDB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PKP4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PLK1 anti bait coimmunoprecipitation, far western blotting, protein kinase assay association, direct interaction, phosphorylation reaction 19468300 , 19468302 , (Europe PMC )0.71 IntAct PPP1CB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PPP2CA phosphatase assay dephosphorylation reaction 18201571 , (Europe PMC )0.44 IntAct, MINT PPP2R5E anti tag coimmunoprecipitation, far western blotting, two hybrid direct interaction, physical association 18201571 , (Europe PMC )0.59 IntAct, MINT PRSS23 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PSMD1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PTPA Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 18201571 , (Europe PMC )NA BioGRID RAB11FIP3 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, competition binding, fluorescence microscopy, pull down association, colocalization, direct interaction, physical association 18511905 , (Europe PMC )0.65 IntAct, MINT RAB11FIP4 pull down direct interaction 18511905 , (Europe PMC )0.44 IntAct, MINT RABL6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RAPGEF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RASIP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct RCC2 Affinity Capture-MS physical 25074804 , (Europe PMC )NA BioGRID RFC1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RND2 Affinity Capture-Western, Reconstituted Complex physical 12590651 , (Europe PMC )NA BioGRID ROCK2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID RPGRIP1L Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct RSRC1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID SAMHD1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SH3KBP1 Affinity Capture-MS physical 19531213 , (Europe PMC )NA BioGRID SHCBP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct SLC26A8 Reconstituted Complex, Two-hybrid physical 11278976 , (Europe PMC )NA BioGRID SLC26A8 pull down, two hybrid physical association 11278976 , (Europe PMC )0.51 IntAct SMNDC1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SNW1 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT STON2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STX18 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID SYBU Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYNCRIP Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TANK Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct TCTN3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TNFRSF8 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRAPPC11 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TRIM27 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TXNDC11 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct VAV1 Reconstituted Complex physical 10748082 , (Europe PMC )NA BioGRID VRK1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID WDR5 Affinity Capture-Western physical 25666610 , (Europe PMC )NA BioGRID YWHAB Affinity Capture-MS, anti bait coimmunoprecipitation, coimmunoprecipitation physical, physical association 15324660 , 17353931 , (Europe PMC )0.59 BioGRID, IntAct, MINT YWHAG Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation association, physical, physical association 15324660 , 17353931 , 26496610 , (Europe PMC )0.69 BioGRID, IntAct, MINT
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
AKT2 T249_WTRSRRKtGTLQPWN , NA NA PhosphoSitePlus , AURKB S144_NAGNKRLsTIDESGS , S185_KKREKRRsTSRQFVD , S187_REKRRSTsRQFVDGP , S387_ETGLYRIsGCDRTVK , S410_VKTVPLLsKVDDIHA , T145_AGNKRLStIDESGSI , T186_KREKRRStSRQFVDG , T249_WTRSRRKtGTLQPWN , in vitro, in vivo 12689593 , 14744859 , 17287340 , 18669648 , 19007248 ,(Europe PMC )HPRD, PhosphoSitePlus , Aurora B S387_ETGLYRIsGCDRTVK , S410_VKTVPLLsKVDDIHA , LTP 12689593 , 15108802 ,(Europe PMC )PhosphoELM , CDK1 T588_PEHQLLKtPSSSSLS , in vitro, in vivo 16565220 , 16964243 , 18201571 , 18669648 , 20068231 ,(Europe PMC )HPRD, CHEK1 S203_GPVKKTRsIGSAVDQ , NA NA PhosphoSitePlus , PLK1 S157_GSILSDIsFDKTDES , S164_SFDKTDEsLDWDSSL , S170_ESLDWDSsLVKTFKL , S214_AVDQGNEsIVAKTTV , T260_QPWNSDStLNSRQLE , NA NA PhosphoSitePlus , Unknown S144_NAGNKRLsTIDESGS , S149_RLSTIDEsGSILSDI , S154_DESGSILsDISFDKT , S157_GSILSDIsFDKTDES , S164_SFDKTDEsLDWDSSL , S169_DESLDWDsSLVKTFK , S170_ESLDWDSsLVKTFKL , S185_KKREKRRsTSRQFVD , S187_REKRRSTsRQFVDGP , S203_GPVKKTRsIGSAVDQ , S206_KKTRSIGsAVDQGNE , S214_AVDQGNEsIVAKTTV , S234_GGPIEAVsTIETVPY , S257_GTLQPWNsDSTLNSR , S533_KVVERLLsLPLEYWS , S540_SLPLEYWsQFMMVEQ , S563_IENSNAFsTPQTPDI , S573_QTPDIKVsLLGPVTT , S590_HQLLKTPsSSSLSQR , S591_QLLKTPSsSSLSQRV , S592_LLKTPSSsSLSQRVR , S593_LKTPSSSsLSQRVRS , S595_TPSSSSLsQRVRSTL , S600_SLSQRVRsTLTKNTP , S628_RQGNFFAsPMLK , T161_SDISFDKtDESLDWD , T201_PPGPVKKtRSIGSAV , T243_IETVPYWtRSRRKTG , T251_RSRRKTGtLQPWNSD , T277_TETDSVGtPQSNGGM , T342_CIPTLIGtPVKIGEG , T564_ENSNAFStPQTPDIK , T567_NAFSTPQtPDIKVSL , T579_VSLLGPVtTPEHQLL , T580_SLLGPVTtPEHQLLK , T588_PEHQLLKtPSSSSLS , T601_LSQRVRStLTKNTPR , T603_QRVRSTLtKNTPRFG , T606_RSTLTKNtPRFGSKS , Y241_STIETVPyWTRSRRK , HTP, in vivo 16565220 , 16964243 , 17081983 , 17287340 , 17924679 , 18212344 , 18452278 , 18669648 , 18691976 , 19007248 , 19651622 , 19691289 , 20068230 , 20068231 , 22067460 ,(Europe PMC )HPRD, PhosphoELM ,