Top
PPP1CA
Localization (UniProt annotation) Cytoplasm Nucleus Nucleus, nucleoplasmNucleus, nucleolus Note=Primarily nuclear and largely excludedfrom the nucleolus Highly mobile in cells and can be relocalizedthrough interaction with targeting subunits NOM1 plays a role intargeting this protein to the nucleolus In the presence of PPP1R8relocalizes from the nucleus to nuclear speckles Function (UniProt annotation) Protein phosphatase that associates with over 200regulatory proteins to form highly specific holoenzymes whichdephosphorylate hundreds of biological targets Proteinphosphatase 1 (PP1) is essential for cell division, andparticipates in the regulation of glycogen metabolism, musclecontractility and protein synthesis Involved in regulation ofionic conductances and long-term synaptic plasticity May play animportant role in dephosphorylating substrates such as thepostsynaptic density-associated Ca(2+)/calmodulin dependentprotein kinase II Component of the PTW/PP1 phosphatase complex,which plays a role in the control of chromatin structure and cellcycle progression during the transition from mitosis intointerphase Regulates NEK2 function in terms of kinase activityand centrosome number and splitting, both in the presence andabsence of radiation-induced DNA damage Regulator of neural tubeand optic fissure closure, and enteric neural crest cell (ENCCs)migration during development In balance with CSNK1D and CSNK1E,determines the circadian period length, through the regulation ofthe speed and rhythmicity of PER1 and PER2 phosphorylation Maydephosphorylate CSNK1D and CSNK1E Dephosphorylates the 'Ser-418'residue of FOXP3 in regulatory T-cells (Treg) from patients withrheumatoid arthritis, thereby inactivating FOXP3 and renderingTreg cells functionally defective (PubMed:23396208)Dephosphorylates CENPA (PubMed:25556658) Dephosphorylates the'Ser-139' residue of ATG16L1 causing dissociation of ATG12-ATG5-ATG16L1 complex, thereby inhibiting autophagy (PubMed:26083323) Catalytic Activity (UniProt annotation) [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate Protein Sequence MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGG
FPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP
IAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPIT
PPRNSAKAKK
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
PPP1CA is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa03015 mRNA surveillance pathway The mRNA surveillance pathway is a quality control mechanism that detects and degrades abnormal mRNAs. These pathways include nonsense-mediated mRNA decay (NMD), nonstop mRNA decay (NSD), and no-go decay (NGD). NMD is a mechanism that eliminates mRNAs containing premature translation-termination codons (PTCs). In vertebrates, PTCs trigger efficient NMD when located upstream of an exon junction complex (EJC). Upf3, together with Upf1 and Upf2, may signal the presence of the PTC to the 5'end of the transcript, resulting in decapping and rapid exonucleolytic digestion of the mRNA. In the NSD pathway, which targets mRNAs lacking termination codons, the ribosome is believed to translate through the 3' untranslated region and stall at the end of the poly(A) tail. NSD involves an eRF3-like protein, Ski7p, which is hypothesized to bind the empty A site of the ribosome and recruit the exosome to degrade the mRNA from the 3' end. NGD targets mRNAs with stalls in translation elongation for endonucleolytic cleavage in a process involving the Dom34 and Hbs1 proteins. hsa04022 cGMP-PKG signaling pathway Cyclic GMP (cGMP) is the intracellular second messenger that mediates the action of nitric oxide (NO) and natriuretic peptides (NPs), regulating a broad array of physiologic processes. The elevated intracellular cGMP level exerts its physiological action through two forms of cGMP-dependent protein kinase (PKG), cGMP-regulated phosphodiesterases (PDE2, PDE3) and cGMP-gated cation channels, among which PKGs might be the primary mediator. PKG1 isoform-specific activation of established substrates leads to reduction of cytosolic calcium concentration and/or decrease in the sensitivity of myofilaments to Ca2+ (Ca2+-desensitization), resulting in smooth muscle relaxation. In cardiac myocyte, PKG directly phosphorylates a member of the transient potential receptor canonical channel family, TRPC6, suppressing this nonselective ion channel's Ca2+ conductance, G-alpha-q agonist-induced NFAT activation, and myocyte hypertrophic responses. PKG also opens mitochondrial ATP-sensitive K+ (mitoKATP) channels and subsequent release of ROS triggers cardioprotection. hsa04024 cAMP signaling pathway cAMP is one of the most common and universal second messengers, and its formation is promoted by adenylyl cyclase (AC) activation after ligation of G protein-coupled receptors (GPCRs) by ligands including hormones, neurotransmitters, and other signaling molecules. cAMP regulates pivotal physiologic processes including metabolism, secretion, calcium homeostasis, muscle contraction, cell fate, and gene transcription. cAMP acts directly on three main targets: protein kinase A (PKA), the exchange protein activated by cAMP (Epac), and cyclic nucleotide-gated ion channels (CNGCs). PKA modulates, via phosphorylation, a number of cellular substrates, including transcription factors, ion channels, transporters, exchangers, intracellular Ca2+ -handling proteins, and the contractile machinery. Epac proteins function as guanine nucleotide exchange factors (GEFs) for both Rap1 and Rap2. Various effector proteins, including adaptor proteins implicated in modulation of the actin cytoskeleton, regulators of G proteins of the Rho family, and phospholipases, relay signaling downstream from Rap. hsa04114 Oocyte meiosis During meiosis, a single round of DNA replication is followed by two rounds of chromosome segregation, called meiosis I and meiosis II. At meiosis I, homologous chromosomes recombine and then segregate to opposite poles, while the sister chromatids segregate from each other at meoisis II. In vertebrates, immature oocytes are arrested at the PI (prophase of meiosis I). The resumption of meiosis is stimulated by progesterone, which carries the oocyte through two consecutive M-phases (MI and MII) to a second arrest at MII. The key activity driving meiotic progression is the MPF (maturation-promoting factor), a heterodimer of CDC2 (cell division cycle 2 kinase) and cyclin B. In PI-arrested oocytes, MPF is initially inactive and is activated by the dual-specificity CDC25C phosphatase as the result of new synthesis of Mos induced by progesterone. MPF activation mediates the transition from the PI arrest to MI. The subsequent decrease in MPF levels, required to exit from MI into interkinesis, is induced by a negative feedback loop, where CDC2 brings about the activation of the APC (anaphase-promoting complex), which mediates destruction of cyclin B. Re-activation of MPF for MII requires re-accumulation of high levels of cyclin B as well as the inactivation of the APC by newly synthesized Emi2 and other components of the CSF (cytostatic factor), such as cyclin E or high levels of Mos. CSF antagonizes the ubiquitin ligase activity of the APC, preventing cyclin B destruction and meiotic exit until fertilization occurs. Fertilization triggers a transient increase in cytosolic free Ca2+, which leads to CSF inactivation and cyclin B destruction through the APC. Then eggs are released from MII into the first embryonic cell cycle. hsa04218 Cellular senescence Cellular senescence is a state of irreversible cellular arrest and can be triggered by a number of factors, such as telomere shortening, oncogene activation, irradiation, DNA damage and oxidative stress. It is characterized by enlarged flattened morphology, senescence-associated beta-galactosidase (SA-b-gal) activity, secretion of inflammatory cytokines, growth factors and matrix metalloproteinases, as part of the senescence-associated secretory phenotype (SASP). Cellular senescence is functionally associated with many biological processes including aging, tumor suppression, placental biology, embryonic development, and wound healing. hsa04261 Adrenergic signaling in cardiomyocytes Cardiac myocytes express at least six subtypes of adrenergic receptor (AR) which include three subtypes of beta-AR (beta-1, beta-2, beta-3) and three subtypes of the alpha-1-AR (alpha-1A, alpha-1B, and alpha-1C). In the human heart the beta-1-AR is the pre- dominate receptor. Acute sympathetic stimulation of cardiac beta-1-ARs induces positive inotropic and chronotropic effects, the most effective mechanism to acutely increase output of the heart, by coupling to Gs, formation of cAMP by adenylyl cyclase (AC), and PKA- dependent phosphorylation of various target proteins (e.g., ryanodine receptor [RyR]; phospholamban [PLB], troponin I [TnI], and the L-type Ca2+ channel [LTCC]). Chronic beta-1-AR stimulation is detrimental and induces cardiomyocyte hypertrophy and apoptosis. beta-2-AR coupled to Gs exerts a proapoptotic action as well as beta-1-AR, while beta-2-AR coupled to Gi exerts an antiapoptotic action. hsa04270 Vascular smooth muscle contraction The vascular smooth muscle cell (VSMC) is a highly specialized cell whose principal function is contraction. On contraction, VSMCs shorten, thereby decreasing the diameter of a blood vessel to regulate the blood flow and pressure. The principal mechanisms that regulate the contractile state of VSMCs are changes in cytosolic Ca2+ concentration ([Ca2+]c). In response to vasoconstrictor stimuli, Ca2+ is mobilized from intracellular stores and/or the extracellular space to increase [Ca2+]c in VSMCs. The increase in [Ca2+]c, in turn, activates the Ca2+-CaM-MLCK pathway and stimulates MLC20 phosphorylation, leading to myosin-actin interactions and, hence, the development of contractile force. The sensitivity of contractile myofilaments or MLC20 phosphorylation to Ca2+ can be secondarily modulated by other signaling pathways. During receptor stimulation, the contractile force is greatly enhanced by the inhibition of myosin phosphatase. Rho/Rho kinase, PKC, and arachidonic acid have been proposed to play a pivotal role in this enhancement. The signaling events that mediate relaxation include the removal of a contractile agonist (passive relaxation) and activation of cyclic nucleotide-dependent signaling pathways in the continued presence of a contractile agonist (active relaxation). Active relaxation occurs through the inhibition of both Ca2+ mobilization and myofilament Ca2+ sensitivity in VSMCs. hsa04390 Hippo signaling pathway Hippo signaling is an evolutionarily conserved signaling pathway that controls organ size from flies to humans. In humans and mice, the pathway consists of the MST1 and MST2 kinases, their cofactor Salvador and LATS1 and LATS2. In response to high cell densities, activated LATS1/2 phosphorylates the transcriptional coactivators YAP and TAZ, promoting its cytoplasmic localization, leading to cell apoptosis and restricting organ size overgrowth. When the Hippo pathway is inactivated at low cell density, YAP/TAZ translocates into the nucleus to bind to the transcription enhancer factor (TEAD/TEF) family of transcriptional factors to promote cell growth and proliferation. YAP/TAZ also interacts with other transcriptional factors or signaling molecules, by which Hippo pathway-mediated processes are interconnected with those of other key signaling cascades, such as those mediated by TGF-beta and Wnt growth factors. hsa04510 Focal adhesion Cell-matrix adhesions play essential roles in important biological processes including cell motility, cell proliferation, cell differentiation, regulation of gene expression and cell survival. At the cell-extracellular matrix contact points, specialized structures are formed and termed focal adhesions, where bundles of actin filaments are anchored to transmembrane receptors of the integrin family through a multi-molecular complex of junctional plaque proteins. Some of the constituents of focal adhesions participate in the structural link between membrane receptors and the actin cytoskeleton, while others are signalling molecules, including different protein kinases and phosphatases, their substrates, and various adapter proteins. Integrin signaling is dependent upon the non-receptor tyrosine kinase activities of the FAK and src proteins as well as the adaptor protein functions of FAK, src and Shc to initiate downstream signaling events. These signalling events culminate in reorganization of the actin cytoskeleton; a prerequisite for changes in cell shape and motility, and gene expression. Similar morphological alterations and modulation of gene expression are initiated by the binding of growth factors to their respective receptors, emphasizing the considerable crosstalk between adhesion- and growth factor-mediated signalling. hsa04611 Platelet activation Platelets play a key and beneficial role for primary hemostasis on the disruption of the integrity of vessel wall. Platelet adhesion and activation at sites of vascular wall injury is initiated by adhesion to adhesive macromolecules, such as collagen and von Willebrand factor (vWF), or by soluble platelet agonists, such as ADP, thrombin, and thromboxane A2. Different receptors are stimulated by various agonists, almost converging in increasing intracellular Ca2+ concentration that stimulate platelet shape change and granule secretion and ultimately induce the inside-outsignaling process leading to activation of the ligand-binding function of integrin alpha IIb beta 3. Binding of alpha IIb beta 3 to its ligands, mainly fibrinogen, mediates platelet adhesion and aggregation and triggers outside-insignaling, resulting in platelet spreading, additional granule secretion, stabilization of platelet adhesion and aggregation, and clot retraction. hsa04720 Long-term potentiation Hippocampal long-term potentiation (LTP), a long-lasting increase in synaptic efficacy, is the molecular basis for learning and memory. Tetanic stimulation of afferents in the CA1 region of the hippocampus induces glutamate release and activation of glutamate receptors in dendritic spines. A large increase in [Ca2+]i resulting from influx through NMDA receptors leads to constitutive activation of CaM kinase II (CaM KII) . Constitutively active CaM kinase II phosphorylates AMPA receptors, resulting in potentiation of the ionic conductance of AMPA receptors. Early-phase LTP (E-LTP) expression is due, in part, to this phosphorylation of the AMPA receptor. It is hypothesized that postsynaptic Ca2+ increases generated through NMDA receptors activate several signal transduction pathways including the Erk/MAP kinase and cAMP regulatory pathways. The convergence of these pathways at the level of the CREB/CRE transcriptional pathway may increase expression of a family of genes required for late-phase LTP (L-LTP). hsa04728 Dopaminergic synapse Dopamine (DA) is an important and prototypical slow neurotransmitter in the mammalian brain, where it controls a variety of functions including locomotor activity, motivation and reward, learning and memory, and endocrine regulation. Once released from presynaptic axonal terminals, DA interacts with at least five receptor subtypes in the central nervous system (CNS), which have been divided into two groups: the D1-like receptors (D1Rs), comprising D1 and D5 receptors, both positively coupled to adenylyl cyclase and cAMP production, and the D2-like receptors (D2Rs), comprising D2, D3, and D4 receptors, whose activation results in inhibition of adenylyl cyclase and suppression of cAMP production. In addition, D1Rs and D2Rs modulate intracellular Ca2+ levels and a number of Ca2+ -dependent intracellular signaling processes. Through diverse cAMP- and Ca2+-dependent and - independent mechanisms, DA influences neuronal activity, synaptic plasticity, and behavior. Presynaptically localized D2Rs regulate synthesis and release of DA as the main autoreceptor of the dopaminergic system. hsa04750 Inflammatory mediator regulation of TRP channels The TRP channels that exhibit a unique response to temperature have been given the name thermo-TRPs. Among all thermo- TRP channels, TRPV1-4, TRPM8, and TRPA1 are expressed in subsets of nociceptive dorsal root ganglion (DRG) neuron cell bodies including their peripheral and central projections. These channels can be modulated indirectly by inflammatory mediators such as PGE2, bradykinin, ATP, NGF, and proinflammatory cytokines that are generated during tissue injury. While the noxious heat receptor TRPV1 is sensitized (that is, their excitability can be increased) by post-translational modifications upon activation of G-protein coupled receptors (GPCRs) or tyrosine kinase receptors, the receptors for inflammatory mediators, the same action appears to mainly desensitize TRPM8, the main somatic innocuous cold sensor. This aforementioned sensitization could allow the receptor to become active at body temperature, so it not only contributes toward thermal hypersensitivity but also is possibly a substrate for ongoing persistent pain. hsa04810 Regulation of actin cytoskeleton hsa04910 Insulin signaling pathway Insulin binding to its receptor results in the tyrosine phosphorylation of insulin receptor substrates (IRS) by the insulin receptor tyrosine kinase (INSR). This allows association of IRSs with the regulatory subunit of phosphoinositide 3-kinase (PI3K). PI3K activates 3-phosphoinositide-dependent protein kinase 1 (PDK1), which activates Akt, a serine kinase. Akt in turn deactivates glycogen synthase kinase 3 (GSK-3), leading to activation of glycogen synthase (GYS) and thus glycogen synthesis. Activation of Akt also results in the translocation of GLUT4 vesicles from their intracellular pool to the plasma membrane, where they allow uptake of glucose into the cell. Akt also leads to mTOR-mediated activation of protein synthesis by eIF4 and p70S6K. The translocation of GLUT4 protein is also elicited through the CAP/Cbl/TC10 pathway, once Cbl is phosphorylated by INSR.Other signal transduction proteins interact with IRS including GRB2. GRB2 is part of the cascade including SOS, RAS, RAF and MEK that leads to activation of mitogen-activated protein kinase (MAPK) and mitogenic responses in the form of gene transcription. SHC is another substrate of INSR. When tyrosine phosphorylated, SHC associates with GRB2 and can thus activate the RAS/MAPK pathway independently of IRS-1. hsa04921 Oxytocin signaling pathway Oxytocin (OT) is a nonapeptide synthesized by the magno-cellular neurons located in the supraoptic (SON) and paraventricular (PVN) nuclei of the hypothalamus. It exerts a wide variety of central and peripheral effects. However, its best-known and most well-established roles are stimulation of uterine contractions during parturition and milk release during lactation. Oxytocin also influences cardiovascular regulation and various social behaviors. The actions of OT are all mediated by one type of OT receptor (OTR). This is a transmembrane receptor belonging to the G-protein-coupled receptor superfamily. The main signaling pathway is the Gq/PLC/Ins3 pathway, but the MAPK and the RhoA/Rho kinase pathways are also activated, contributing to increased prostaglandin production and direct contractile effect on myometrial cells. In the cardiovascular system, OTR is associated with the ANP-cGMP and NO-cGMP pathways, which reduce the force and rate of contraction and increase vasodilatation. hsa04931 Insulin resistance Insulin resistance is a condition where cells become resistant to the effects of insulin. It is often found in people with health disorders, including obesity, type 2 diabetes mellitus, non-alcoholic fatty liver disease, and cardiovascular diseases. In this diagram multiple mechanisms underlying insulin resistance are shown: (a) increased phosphorylation of IRS (insulin receptor substrate) protein through serine/threonine kinases, such as JNK1 and IKKB, and protein kinase C, (b) increased IRS-1 proteasome degradation via mTOR signaling pathway, (c) decreased activation of signaling molecules including PI3K and AKT, (d) increase in activity of phosphatases including PTPs, PTEN, and PP2A. Regulatory actions such as oxidative stress, mitochondrial dysfunction, accumulation of intracellular lipid derivatives (diacylglycrol and ceramides), and inflammation (via IL-6 and TNFA) contribute to these mechanisms. Consequently, insulin resistance causes reduced GLUT4 translocation, resulting in glucose takeup and glycogen synthesis in skeletal muscle as well as increased hepatic gluconeogenesis and decreased glycogen synthesis in liver. At the bottom of the diagram, interplay between O-GlcNAcylation and serine/threonine phosphorylation is shown. Studies suggested that elevated O-GlcNAc level was correlated to high glucose-induced insulin resistance. Donor UDP-GlcNAc is induced through hexosamine biosynthesis pathway and added to proteins by O-GlcNAc transferase. Elevation of O-GlcNAc modification alters phosphorylation and function of key insulin signaling proteins including IRS-1, PI3K, PDK1, Akt and other transcription factor and cofactors, resulting in the attenuation of insulin signaling cascade. hsa05031 Amphetamine addiction Amphetamine is a psychostimulant drug that exerts persistent addictive effects. Most addictive drugs increase extracellular concentrations of dopamine (DA) in nucleus accumbens (NAc) and medial prefrontal cortex (mPFC), projection areas of mesocorticolimbic DA neurons and key components of the brain reward circuit. Amphetamine achieves this elevation in extracellular levels of DA by promoting efflux from synaptic terminals. Acute administration of amphetamine induces phosphorylation of cAMP response element-binding protein (CREB) and expression of a number of immediate early genes (IEGs), such as c-fos. The IEGs is likely to initiate downstream molecular events, which may have important roles in the induction and maintenance of addictive states. Chronic exposure to amphetamine induces a unique transcription factor delta FosB, which plays an essential role in long-term adaptive changes in the brain. hsa05034 Alcoholism Alcoholism, also called dependence on alcohol (ethanol), is a chronic relapsing disorder that is progressive and has serious detrimental health outcomes. As one of the primary mediators of the rewarding effects of alcohol, dopaminergic ventral tegmental area (VTA) projections to the nucleus accumbens (NAc) have been identified. Acute exposure to alcohol stimulates dopamine release into the NAc, which activates D1 receptors, stimulating PKA signaling and subsequent CREB-mediated gene expression, whereas chronic alcohol exposure leads to an adaptive downregulation of this pathway, in particular of CREB function. The decreased CREB function in the NAc may promote the intake of drugs of abuse to achieve an increase in reward and thus may be involved in the regulation of positive affective states of addiction. PKA signaling also affects NMDA receptor activity and may play an important role in neuroadaptation in response to chronic alcohol exposure. hsa05168 Herpes simplex infection Herpes simplex virus (HSV) infections are very common worldwide, with the prevalence of HSV-1 reaching up to 80%-90%. Primary infection with HSV takes place in the mucosa, followed by the establishment of latent infection in neuronal ganglia. HSV is the main cause of herpes infections that lead to the formation of characteristic blistering lesion. HSV express multiple viral accessory proteins that interfere with host immune responses and are indispensable for viral replication. Among these proteins, the immediate early (IE) gene ICP0, ICP4, and ICP27 are essential for regulation of HSV gene expression in productive infection. On the other hand, ORF P and ORF O gene are transcribed during latency and blocks the expression of the IE genes, thus maintaining latent infection. hsa05205 Proteoglycans in cancer Many proteoglycans (PGs) in the tumor microenvironment have been shown to be key macromolecules that contribute to biology of various types of cancer including proliferation, adhesion, angiogenesis and metastasis, affecting tumor progress. The four main types of proteoglycans include hyaluronan (HA), which does not occur as a PG but in free form, heparan sulfate proteoglycans (HSPGs), chondroitin sulfate proteoglycans (CSPGs), dematan sulfate proteoglycans (DSPG) and keratan sulfate proteoglycans (KSPGs) [BR:00535]. Among these proteoglycans such as HA, acting with CD44, promotes tumor cell growth and migration, whereas other proteoglycans such as syndecans (-1~-4), glypican (-1, -3) and perlecan may interact with growth factors, cytokines, morphogens and enzymes through HS chains [BR: 00536], also leading to tumor growth and invasion. In contrast, some of the small leucine-rich proteolgycans, such as decorin and lumican, can function as tumor repressors, and modulate the signaling pathways by the interaction of their core proteins and multiple receptors.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-163560 Triglyceride catabolism. Triacylglycerol is a major energy store in the body and its hydrolysis to yield fatty acids and glycerol is a tightly regulated part of energy metabolism. A central part in this regulation is played by hormone-sensitive lipase (HSL), a neutral lipase abundant in adipocytes and skeletal and cardiac muscle, but also abundant in ovarian and adrenal tissue, where it mediates cholesterol ester hydrolysis, yielding cholesterol for steroid biosynthesis. The hormones to which it is sensitive include catecholamines (e.g., epinephrine), ACTH, and glucagon, all of which trigger signaling cascades that lead to its phosphorylation and activation, and insulin, which sets off events leading to its dephosphorylation and inactivation (Holm et al. 2000; Kraemer and Shen 2002).<p>The processes of triacylglycerol and cholesterol ester hydrolysis are also regulated by subcellular compartmentalization: these lipids are packaged in cytosolic particles and the enzymes responsible for their hydrolysis, and perhaps for additional steps in their metabolism, are organized at the surfaces of these particles (e.g., Brasaemle et al. 2004). This organization is dynamic: the inactive form of HSL is not associated with the particles, but is translocated there after being phosphorylated. Conversely, perilipin, a major constituent of the particle surface, appears to block access of enzymes to the lipids within the particle; its phosphorylation allows greater access. <p>Here, HSL-mediated triacylglycerol hydrolysis is described as a pathway containing twelve reactions. The first six of these involve activation: phosphorylation of HSL, dimerization of HSL, disruption of CGI-58:perilipin complexes at the surfaces of cytosolic lipid particles, phosphorylation of perilipin, association of phosphorylated HSL with FABP, and translocation of HSL from the cytosol to the surfaces of lipid particles. The next four reactions are the hydrolysis reactions themselves: the hydrolysis of cholesterol esters, and the successive removal of three fatty acids from triacylglycerol. The last two reactions, dephosphorylation of perilipin and HSL, negatively regulate the pathway. These events are outlined in the figure below. Inputs (substrates) and outputs (products) of individual reactions are connected by black arrows; blue lines connect output activated enzymes to the other reactions that they catalyze. <p>Despite the undoubted importance of these reactions in normal human energy metabolism and in the pathology of diseases such as type II diabetes, they have been studied only to a limited extent in human cells and tissues. Most experimental data are derived instead from two rodent model systems: primary adipocytes from rats, and mouse 3T3-L1 cells induced to differentiate into adipocytes R-HSA-180024 DARPP-32 events. Dopamine- and cAMP-regulated phosphoprotein, Mr 32 kDa (DARPP-32), was identified as a major target for dopamine and protein kinase A (PKA) in striatum. Recent advances now indicate that regulation DARPP-32 phosphorylation provides a mechanism for integrating information arriving at dopaminoceptive neurons, in multiple brain regions, via a variety of neurotransmitters, neuromodulators, neuropeptides, and steroid hormones. Activation of PKA or PKG stimulates DARPP-32 phosphorylation at Thr34, converting DARPP-32 into a potent inhibitor of protein phosphatase-1 (PP-1). DARPP-32 is also phosphorylated at Thr75 by Cdk5, converting DARPP-32 into an inhibitor of PKA. Thus, DARPP-32 has the unique property of being a dual-function protein, acting either as an inhibitor of PP-1 or of PKA R-HSA-2173788 Downregulation of TGF-beta receptor signaling. TGF-beta receptor signaling is downregulated by proteasome and lysosome-mediated degradation of ubiquitinated TGFBR1, SMAD2 and SMAD3, as well as by dephosphorylation of TGFBR1, SMAD2 and SMAD3. In the nucleus, SMAD2/3:SMAD4 complex stimulates transcription of SMAD7, an inhibitory SMAD (I-SMAD). SMAD7 binds phosphorylated TGFBR1 and competes with the binding of SMAD2 and SMAD3 (Hayashi et al. 1997, Nakao et al. 1997). Binding of SMAD7 to TGBR1 can be stabilized by STRAP, a protein that simultaneously binds SMAD7 and TGFBR1 (Datta et al. 2000). BAMBI simultaneously binds SMAD7 and activated TGFBR1, leading to downregulation of TGF-beta receptor complex signaling (Onichtchouk et al. 1999, Yan et al. 2009). In addition to competing with SMAD2/3 binding to TGFBR1, SMAD7 recruits protein phosphatase PP1 to phosphorylated TGFBR1, by binding to the PP1 regulatory subunit PPP1R15A (GADD34). PP1 dephosphorylates TGFBR1, preventing the activation of SMAD2/3 and propagation of TGF-beta signal (Shi et al. 2004). SMAD7 associates with several ubiquitin ligases, SMURF1 (Ebisawa et al. 2001, Suzuki et al. 2002, Tajima et al. 2003, Chong et al. 2010), SMURF2 (Kavsak et al. 2000, Ogunjimi et al. 2005), and NEDD4L (Kuratomi et al. 2005), and recruits them to phosphorylated TGFBR1 within TGFBR complex. SMURF1, SMURF2 and NEDD4L ubiquitinate TGFBR1 (and SMAD7), targeting TGFBR complex for proteasome and lysosome-dependent degradation (Ebisawa et al. 2001, Kavsak et al. 2000, Kuratomi et al. 2005). The ubiquitination of TGFBR1 can be reversed by deubiquitinating enzymes, UCHL5 (UCH37) and USP15, which may be recruited to ubiquitinated TGFBR1 by SMAD7 (Wicks et al. 2005, Eichhorn et al. 2012). Basal levels of SMAD2 and SMAD3 are maintained by SMURF2 and STUB1 ubiquitin ligases. SMURF2 is able to bind and ubiquitinate SMAD2, leading to SMAD2 degradation (Zhang et al. 2001), but this has been questioned by a recent study of Smurf2 knockout mice (Tang et al. 2011). STUB1 (CHIP) binds and ubiquitinates SMAD3, leading to SMAD3 degradation (Li et al. 2004, Xin et al. 2005). PMEPA1 can bind and sequester unphosphorylated SMAD2 and SMAD3, preventing their activation in response to TGF-beta signaling. In addition, PMEPA1 can bind and sequester phosphorylated SMAD2 and SMAD3, preventing formation of SMAD2/3:SMAD4 heterotrimer complexes (Watanabe et al. 2010). A protein phosphatase MTMR4, residing in the membrane of early endosomes, can dephosphorylate activated SMAD2 and SMAD3, preventing formation of SMAD2/3:SMAD4 complexes (Yu et al. 2010) R-HSA-400253 Circadian Clock. At the center of the mammalian circadian clock is a negative transcription/translation-based feedback loop: The BMAL1:CLOCK/NPAS2 (ARNTL:CLOCK/NPAS2) heterodimer transactivates CRY and PER genes by binding E-box elements in their promoters; the CRY and PER proteins then inhibit transactivation by BMAL1:CLOCK/NPAS2. BMAL1:CLOCK/NPAS2 activates transcription of CRY, PER, and several other genes in the morning. Levels of PER and CRY proteins rise during the day and inhibit expression of CRY, PER, and other BMAL1:CLOCK/NPAS2-activated genes in the afternoon and evening. During the night CRY and PER proteins are targeted for degradation by phosphorylation and polyubiquitination, allowing the cycle to commence again in the morning. Transcription of the BMAL1 (ARNTL) gene is controlled by ROR-alpha and REV-ERBA (NR1D1), both of which are targets of BMAL1:CLOCK/NPAS2 in mice and both of which compete for the same element (RORE) in the BMAL1 promoter. ROR-alpha (RORA) activates transcription of BMAL1; REV-ERBA represses transcription of BMAL1. This mutual control forms a secondary, reinforcing loop of the circadian clock. REV-ERBA shows strong circadian rhythmicity and confers circadian expression on BMAL1. BMAL1 can form heterodimers with either CLOCK or NPAS2, which act redundantly but show different tissue specificity. The BMAL1:CLOCK and BMAL1:NPAS2 heterodimers activate a set of genes that possess E-box elements (consensus CACGTG) in their promoters. This confers circadian expression on the genes. The PER genes (PER1, PER2, PER3) and CRY genes (CRY1, CRY2) are among those activated by BMAL1:CLOCK and BMAL1:NPAS2. PER and CRY mRNA accumulates during the morning and the proteins accumulate during the afternoon. PER and CRY proteins form complexes in the cytosol and these are bound by either CSNK1D or CSNK1E kinases which phosphorylate PER and CRY. The phosphorylated PER:CRY:kinase complex is translocated into the nucleus due to the nuclear localization signal of PER and CRY. Within the nucleus the PER:CRY complexes bind BMAL1:CLOCK and BMAL1:NPAS2, inhibiting their transactivation activity and their phosphorylation. This reduces expression of the target genes of BMAL1:CLOCK and BMAL1:NPAS2 during the afternoon and evening. PER:CRY complexes also traffic out of the nucleus into the cytosol due to the nuclear export signal of PER. During the night PER:CRY complexes are polyubiquitinated and degraded, allowing the cycle to begin again. Phosphorylated PER is bound by Beta-TrCP1, a cytosolic F-box type component of some SCF E3 ubiquitin ligases. CRY is bound by FBXL3, a nucleoplasmic F-box type component of some SCF E3 ubiquitin ligases. Phosphorylation of CRY1 by Adenosine monophosphate-activated kinase (AMPK) enhances degradation of CRY1. PER and CRY are subsequently polyubiquitinated and proteolyzed by the 26S proteasome.The circadian clock is cell-autonomous and some, but not all cells of the body exhibit circadian rhythms in metabolism, cell division, and gene transcription. The suprachiasmatic nucleus (SCN) in the hypothalamus is the major clock in the body and receives its major input from light (via retinal neurons) and a minor input from nutrient intake. The SCN and other brain tissues determine waking and feeding cycles and influence the clocks in other tissues by hormone secretion and nervous stimulation. Independently of the SCN, other tissues such as liver receive inputs from signals from the brain and from nutrients
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AATK Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 22321011 , 25852190 , 28065597 , (Europe PMC )0.55 BioGRID, IntAct ACTA1 Affinity Capture-Western physical 15107502 , (Europe PMC )NA BioGRID ACTB Affinity Capture-MS, Co-fractionation physical 17683050 , 22939629 , (Europe PMC )NA BioGRID AKAP11 Affinity Capture-Western, Reconstituted Complex physical 10209101 , 12147701 , (Europe PMC )NA BioGRID AKT1 Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, fluorescence microscopy, phosphatase assay colocalization, dephosphorylation reaction, physical, physical association 14645548 , 16186112 , 20186153 , (Europe PMC )0.57 BioGRID, IntAct, MINT ALDH7A1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ANLN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct APAF1 Affinity Capture-Western, anti bait coimmunoprecipitation, antibody array physical, physical association 17274640 , (Europe PMC )0.52 BioGRID, IntAct AR Affinity Capture-Western physical 26636645 , (Europe PMC )NA BioGRID ARNTL Affinity Capture-Western physical 23555304 , (Europe PMC )NA BioGRID ASF1A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ASNS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ATM Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct AURKA Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 11551964 , (Europe PMC )NA BioGRID AURKB Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct AXIN1 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17318175 , (Europe PMC )0.52 BioGRID, IntAct, MINT BAD Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct BCL2 Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct BCL2L1 Affinity Capture-Western, Reconstituted Complex, antibody array physical, physical association 12115603 , 17274640 , (Europe PMC )0.40 BioGRID, IntAct BCL2L2 Affinity Capture-Western, Reconstituted Complex physical 12115603 , (Europe PMC )NA BioGRID BRAF Affinity Capture-MS physical 27034005 , (Europe PMC )NA BioGRID BRCA1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 12438214 , 17511879 , 22990118 , 25056273 , (Europe PMC )0.52 BioGRID, IntAct BTBD10 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct C12orf57 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID C1QA Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct C20orf27 Affinity Capture-MS, inference by socio-affinity scoring, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.64 BioGRID, IntAct CAPNS1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CAPZA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CAV1 Affinity Capture-Western, Reconstituted Complex physical 14645548 , (Europe PMC )NA BioGRID CCDC181 Two-hybrid physical 15231748 , (Europe PMC )NA BioGRID CCDC6 Co-localization physical 20498639 , (Europe PMC )NA BioGRID CCDC85B Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct CCDC85C Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct CCNA1 Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID CCNB1 Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID CCND3 Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID CD2BP2 Affinity Capture-MS, Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 19389623 , 22365833 , 27880917 , 28561026 , (Europe PMC )0.59 BioGRID, IntAct, MINT CDC5L Affinity Capture-MS, Co-purification, anti bait coimmunoprecipitation, phosphatase assay association, dephosphorylation reaction, physical 11101529 , 20467437 , 22940584 , (Europe PMC )0.59 BioGRID, IntAct, MINT CDCA2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CDH1 Affinity Capture-Western, Proximity Label-MS, anti bait coimmunoprecipitation, antibody array physical, physical association 17274640 , 25468996 , (Europe PMC )0.52 BioGRID, IntAct CDK1 Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct CDK2 Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct CDK4 Affinity Capture-Western, Co-fractionation, antibody array physical, physical association 17274640 , 22939629 , (Europe PMC )0.40 BioGRID, IntAct CEP126 Two-hybrid physical 22321011 , (Europe PMC )NA BioGRID CEP170 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CHMP2A Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID CHUK Affinity Capture-Western physical 18949366 , (Europe PMC )NA BioGRID CKB Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CLCN2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CLOCK Affinity Capture-Luminescence, Affinity Capture-Western, Two-hybrid physical 23555304 , (Europe PMC )NA BioGRID CLTC Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CNP Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CNST Affinity Capture-MS, Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 19389623 , 22321011 , 26186194 , 28514442 , (Europe PMC )0.66 BioGRID, IntAct CNTN1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CREB1 Biochemical Activity physical 20498639 , (Europe PMC )NA BioGRID CRK Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CSNK1E Biochemical Activity physical 17318175 , (Europe PMC )NA BioGRID CSNK2B Two-hybrid, two hybrid physical, physical association 23555304 , (Europe PMC )0.37 BioGRID, IntAct CSRNP1 Affinity Capture-MS, Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 22321011 , 25416956 , 26186194 , 28514442 , (Europe PMC )0.76 BioGRID, IntAct CSRNP2 Affinity Capture-MS, Two-hybrid, far western blotting, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid direct interaction, physical, physical association 15231748 , 19389623 , 25416956 , 26186194 , 28514442 , (Europe PMC )0.84 BioGRID, IntAct, MINT CTDP1 Affinity Capture-Western physical 12036313 , (Europe PMC )NA BioGRID CUEDC2 Affinity Capture-Western physical 18362886 , (Europe PMC )NA BioGRID CUL1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CXXC1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct DBN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DCAF7 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , (Europe PMC )0.51 BioGRID, IntAct DCTN1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct DCX Affinity Capture-Western, Co-localization physical 19094064 , (Europe PMC )NA BioGRID DDX1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID DEAF1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct DEC1 Two-hybrid physical 23555304 , (Europe PMC )NA BioGRID DLD Affinity Capture-MS, anti bait coimmunoprecipitation, cross-linking study association, physical 25593058 , 29128334 , (Europe PMC )0.53 BioGRID, IntAct DPYSL2 Affinity Capture-MS physical 17683050 , (Europe PMC )NA BioGRID ECT2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID EED Reconstituted Complex physical 12788942 , (Europe PMC )NA BioGRID EIF2AK2 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 12138106 , (Europe PMC )NA BioGRID EIF2AK4 Affinity Capture-MS physical 26186194 , 27880917 , 28514442 , (Europe PMC )NA BioGRID ERBIN Affinity Capture-MS physical 26186194 , 27880917 , 28514442 , (Europe PMC )NA BioGRID ESR1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct FLNA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct FRMPD4 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct GLIPR1L2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct GPKOW Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT GPN3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21706016 , (Europe PMC )0.35 BioGRID, IntAct GSK3A Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID GSK3B Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 12147701 , 23455922 , 27880917 , (Europe PMC )0.35 BioGRID, IntAct GYG1 Affinity Capture-MS, pull down association, physical 26186194 , 28330616 , (Europe PMC )0.35 BioGRID, IntAct GYS1 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct GYS2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HCFC1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex physical 10637318 , 22939629 , (Europe PMC )NA BioGRID HDAC1 Affinity Capture-Western physical 16186112 , 17008050 , (Europe PMC )NA BioGRID HDAC3 Affinity Capture-Western physical 16186112 , (Europe PMC )NA BioGRID HDAC5 Affinity Capture-MS physical 21081666 , (Europe PMC )NA BioGRID HDAC6 Affinity Capture-Western physical 16186112 , (Europe PMC )NA BioGRID HEYL Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT HOMEZ Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HSD17B10 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct HSPA1L Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct HSPA4 Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS, Affinity Capture-Western physical 17683050 , 9269769 , (Europe PMC )NA BioGRID HUWE1 Affinity Capture-MS physical 25147182 , (Europe PMC )NA BioGRID IBTK Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct IKBKB Affinity Capture-Western physical 18362886 , 18949366 , (Europe PMC )NA BioGRID INA Affinity Capture-MS physical 17683050 , (Europe PMC )NA BioGRID IQGAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID JPH3 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct KANK1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct KCNQ1 Affinity Capture-Western, Reconstituted Complex physical 11799244 , (Europe PMC )NA BioGRID KCTD20 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KIF13B Affinity Capture-Western physical 19094064 , (Europe PMC )NA BioGRID KIF18A Affinity Capture-MS, Two-hybrid, inference by socio-affinity scoring, tandem affinity purification, two hybrid association, physical, physical association 15231748 , 26186194 , 27173435 , 27880917 , 28514442 , (Europe PMC )0.64 BioGRID, IntAct, MINT KIF1BP Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID KNL1 Affinity Capture-MS, Two-hybrid physical 15231748 , 26186194 , 27880917 , 28514442 , (Europe PMC )NA BioGRID LATS1 Affinity Capture-Western physical 26116754 , (Europe PMC )NA BioGRID LBR Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID LEO1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID LIMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LMTK2 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid physical 12393858 , 28065597 , (Europe PMC )NA BioGRID LNX1 Affinity Capture-MS physical 29121065 , (Europe PMC )NA BioGRID LPIN2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct LRRC1 Affinity Capture-MS physical 26186194 , 27880917 , 28514442 , (Europe PMC )NA BioGRID MAFG Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct MAL2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct MAP4K4 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct MAPRE1 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , (Europe PMC )0.51 BioGRID, IntAct MAPRE2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAT2B Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID MATR3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MAX Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID MDC1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID MDM2 Affinity Capture-Western physical 26636645 , (Europe PMC )NA BioGRID MDM4 Affinity Capture-Western physical 23277204 , (Europe PMC )NA BioGRID MIIP Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct MKI67 Affinity Capture-MS physical 26186194 , 27880917 , 28514442 , (Europe PMC )NA BioGRID MPHOSPH10 Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , (Europe PMC )0.59 BioGRID, IntAct, MINT MST1R Affinity Capture-Western, Biochemical Activity physical 14505491 , (Europe PMC )NA BioGRID MTX2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYC Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MYH9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO18A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO19 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO5C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NCAM1 Reconstituted Complex physical 23061666 , (Europe PMC )NA BioGRID NCOR1 Affinity Capture-Western physical 12410313 , (Europe PMC )NA BioGRID NDP Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct NEK2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct NFATC2 Affinity Capture-MS physical 27637333 , (Europe PMC )NA BioGRID NINL Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct NOC2L Reconstituted Complex physical 10637318 , (Europe PMC )NA BioGRID NOM1 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT NONO Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 21566083 , (Europe PMC )NA BioGRID NOP53 Two-hybrid physical 22321011 , (Europe PMC )NA BioGRID NR3C2 Affinity Capture-Western physical 28454724 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NUP153 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26186194 , 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID OGT Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PACS1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PAK1 Biochemical Activity physical 18586681 , (Europe PMC )NA BioGRID PARD3 Affinity Capture-Western physical 26116754 , (Europe PMC )NA BioGRID PARD6B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PDRG1 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct PEAK1 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct PFDN2 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 27880917 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct PFDN6 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 27880917 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct PHACTR1 Affinity Capture-Western, Two-hybrid physical 15107502 , (Europe PMC )NA BioGRID PHACTR3 Affinity Capture-Western, Far Western, Two-hybrid, pull down, two hybrid association, physical, physical association 12925532 , 22321011 , 28330616 , (Europe PMC )0.55 BioGRID, IntAct PHACTR4 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PHC1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PIAS1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PIAS3 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PIH1D1 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct PKM Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PLCL2 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 15231748 , 26186194 , 27880917 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT POLR2A Biochemical Activity physical 12052871 , (Europe PMC )NA BioGRID POLR2E Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct POLR3A Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct POLR3B Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID POLR3E Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PPP1CB Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, inference by socio-affinity scoring association, physical, physical association 22939629 , 26186194 , 26344197 , 26496610 , 27173435 , 28514442 , (Europe PMC )0.51 BioGRID, IntAct PPP1CC Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 24366813 , 26186194 , 26344197 , 26496610 , 27173435 , 28330616 , 28514442 , (Europe PMC )0.81 BioGRID, IntAct PPP1R10 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 10637318 , 12574161 , 15231748 , 20516061 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.61 BioGRID, IntAct, MINT PPP1R11 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct PPP1R13B Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 15231748 , 21998301 , 22321011 , 24366813 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.89 BioGRID, IntAct, MINT PPP1R13L Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid association, physical, physical association 21998301 , 22321011 , 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.86 BioGRID, IntAct, MINT PPP1R15A Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, pull down, two hybrid association, physical, physical association 12016208 , 12724406 , 15231748 , 29109149 , (Europe PMC )0.61 BioGRID, IntAct, MINT PPP1R15B Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 15231748 , 21382349 , 22321011 , 28330616 , (Europe PMC )0.78 BioGRID, IntAct, MINT PPP1R16A Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PPP1R16B Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 28514442 , (Europe PMC )0.49 BioGRID, IntAct PPP1R18 Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 22321011 , 25593058 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.70 BioGRID, IntAct PPP1R1B Affinity Capture-MS physical 17683050 , (Europe PMC )NA BioGRID PPP1R2 Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, filter binding, inference by socio-affinity scoring, molecular sieving, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid, x ray scattering association, direct interaction, physical, physical association 10807923 , 20826336 , 22321011 , 25593058 , 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.94 BioGRID, IntAct, MINT PPP1R26 Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , (Europe PMC )0.59 BioGRID, IntAct, MINT PPP1R2B Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID PPP1R32 Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 19389623 , 21382349 , (Europe PMC )0.66 BioGRID, IntAct PPP1R37 Affinity Capture-MS, Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, direct interaction, physical, physical association 15231748 , 19389623 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.73 BioGRID, IntAct, MINT PPP1R3A Affinity Capture-MS physical 24366813 , (Europe PMC )NA BioGRID PPP1R3B Affinity Capture-MS, Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 15231748 , 26186194 , (Europe PMC )0.62 BioGRID, IntAct, MINT PPP1R3C Two-hybrid physical 22321011 , (Europe PMC )NA BioGRID PPP1R3D Affinity Capture-MS, Two-hybrid, pull down, two hybrid association, physical, physical association 22321011 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.55 BioGRID, IntAct PPP1R3E Two-hybrid, pull down, two hybrid association, physical, physical association 22321011 , 28330616 , (Europe PMC )0.55 BioGRID, IntAct PPP1R3G Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PPP1R7 Affinity Capture-MS, anti bait coimmunoprecipitation, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 25593058 , 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.79 BioGRID, IntAct PPP1R8 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, inference by socio-affinity scoring, ion exchange chromatography, isothermal titration calorimetry, molecular sieving, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach, x-ray crystallography association, direct interaction, physical, physical association 10637318 , 12788942 , 15231748 , 18842582 , 20516061 , 20671031 , 22365833 , 22939629 , 22940584 , 25593058 , 26186194 , 26344197 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.49, 0.69, 0.90 BioGRID, IntAct, MINT PPP1R9A Affinity Capture-MS, pull down association, physical 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct PPP1R9B Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid association, physical, physical association 10194355 , 15231748 , 19094064 , 22321011 , 25593058 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.75 BioGRID, IntAct, MINT PPP2R5C Affinity Capture-Western, Two-hybrid, two hybrid physical, physical association 25487150 , (Europe PMC )0.37 BioGRID, IntAct PPP2R5D Affinity Capture-Western physical 25487150 , (Europe PMC )NA BioGRID PPP2R5E Two-hybrid, two hybrid physical, physical association 23555304 , (Europe PMC )0.37 BioGRID, IntAct PQBP1 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID PREX1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PRKAR1A Affinity Capture-Western physical 16582606 , (Europe PMC )NA BioGRID PRKCB Biochemical Activity physical 8749392 , (Europe PMC )NA BioGRID PRR16 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PTEN Affinity Capture-Western, anti bait coimmunoprecipitation, antibody array physical, physical association 17274640 , (Europe PMC )0.52 BioGRID, IntAct PTK2 Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID PTPA Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID PTPN7 Biochemical Activity physical 14613483 , (Europe PMC )NA BioGRID RANBP9 Two-hybrid, two hybrid physical, physical association 21382349 , 22321011 , (Europe PMC )0.55 BioGRID, IntAct RASSF10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct RASSF7 Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical 24366813 , 26186194 , 28330616 , 28514442 , (Europe PMC )0.60 BioGRID, IntAct RASSF8 Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical 24366813 , 26186194 , 28330616 , 28514442 , (Europe PMC )0.60 BioGRID, IntAct RASSF9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct RB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, antibody array, coimmunoprecipitation, pull down, two hybrid direct interaction, physical, physical association 12434308 , 17008050 , 17274640 , 8384581 , (Europe PMC )0.77 BioGRID, IntAct, MINT RIF1 Affinity Capture-MS, Two-hybrid physical 22321011 , 26186194 , 27173435 , 27880917 , 28514442 , (Europe PMC )NA BioGRID RORC Two-hybrid, two hybrid physical, physical association 23555304 , (Europe PMC )0.37 BioGRID, IntAct RPAP2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RPAP3 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 17643375 , 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct RPL13 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID RPRD2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct RPS24 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RRP1B Affinity Capture-MS, Reconstituted Complex, pull down, tandem affinity purification association, direct interaction, physical 10637318 , 19389623 , 19710015 , (Europe PMC )0.35, 0.44 BioGRID, IntAct RUVBL1 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct RUVBL2 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 17643375 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct RYR2 Co-fractionation physical 10830164 , (Europe PMC )NA BioGRID SCPEP1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SCRIB Affinity Capture-MS physical 26186194 , 27880917 , 28514442 , (Europe PMC )NA BioGRID SF3A2 Affinity Capture-MS, affinity chromatography technology physical, physical association 17332742 , (Europe PMC )0.40 BioGRID, IntAct, MINT SFPQ Affinity Capture-Western, Biochemical Activity physical 21566083 , (Europe PMC )NA BioGRID SFRP1 Affinity Capture-Western, Two-hybrid physical 17123353 , 21382349 , (Europe PMC )NA BioGRID SFRP2 Affinity Capture-Western physical 17123353 , (Europe PMC )NA BioGRID SFRP5 Affinity Capture-Western physical 17123353 , (Europe PMC )NA BioGRID SH2D4A Affinity Capture-MS, far western blotting, pull down direct interaction, physical, physical association 19389623 , 28514442 , (Europe PMC )0.54 BioGRID, IntAct SH3RF2 Affinity Capture-Western, Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 19389623 , 19945436 , 22321011 , (Europe PMC )0.66 BioGRID, IntAct SHOC2 Affinity Capture-MS physical 26186194 , 27880917 , 28514442 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SKP1 Affinity Capture-Western, anti bait coimmunoprecipitation, antibody array physical, physical association 17274640 , (Europe PMC )0.52 BioGRID, IntAct SKP2 Affinity Capture-Western physical 26636645 , (Europe PMC )NA BioGRID SLC45A1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct SMARCA5 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SMARCB1 Affinity Capture-Western, Phenotypic Enhancement, Reconstituted Complex genetic, physical 12016208 , (Europe PMC )NA BioGRID SNCAIP Co-localization, Two-hybrid, two hybrid physical, physical association 22321011 , 24902662 , (Europe PMC )0.37 BioGRID, IntAct SNW1 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT SON Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SORL1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct SPRED1 Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , 22321011 , (Europe PMC )0.74 BioGRID, IntAct, MINT SRSF11 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SRSF5 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SRSF7 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID STAM Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT STAU1 Affinity Capture-Western, Two-hybrid, two hybrid physical, physical association 15231748 , 15303970 , 22321011 , (Europe PMC )0.55 BioGRID, IntAct, MINT STK24 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID STX1A Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID SUPT6H Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SYNCRIP Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SYNPO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYTL2 Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , (Europe PMC )0.59 BioGRID, IntAct, MINT TANC2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TBCB Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TCTEX1D4 Two-hybrid, two hybrid physical, physical association 21382349 , (Europe PMC )0.37 BioGRID, IntAct TERF2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID TES Affinity Capture-MS physical 28378594 , (Europe PMC )NA BioGRID TFG Affinity Capture-MS physical 17683050 , (Europe PMC )NA BioGRID TMOD3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TNFRSF1A Affinity Capture-Western physical 18949366 , (Europe PMC )NA BioGRID TOE1 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT TOR1AIP1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct TOX4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, proximity-dependent biotin identification, pull down association, physical 20516061 , 27880917 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct TP53 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT TP53BP2 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 15231748 , 21189257 , 21998301 , 22321011 , 24366813 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.86 BioGRID, IntAct, MINT TPBG Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TPRN Affinity Capture-MS, Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 15231748 , 22321011 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.49, 0.61 BioGRID, IntAct TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRIM28 Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex physical 20424263 , (Europe PMC )NA BioGRID TUSC3 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBE2Z Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct UBXN2A Affinity Capture-MS physical 26389662 , (Europe PMC )NA BioGRID UBXN2B Affinity Capture-MS physical 26389662 , (Europe PMC )NA BioGRID ULK1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct URI1 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27780869 , 27880917 , 28330616 , 28514442 , 28561026 , (Europe PMC )0.69 BioGRID, IntAct UXT Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct VTN Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID WBP11 Affinity Capture-MS, Two-hybrid, inference by socio-affinity scoring, tandem affinity purification, two hybrid association, physical, physical association 22321011 , 22365833 , 26186194 , 27173435 , 27880917 , 28514442 , (Europe PMC )0.73 BioGRID, IntAct, MINT WDR82 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, proximity-dependent biotin identification, pull down association, physical 20516061 , 27880917 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct WDR92 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , 28561026 , (Europe PMC )0.69 BioGRID, IntAct WWOX Affinity Capture-MS physical 24550385 , (Europe PMC )NA BioGRID WWTR1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity physical 21189257 , 26116754 , (Europe PMC )NA BioGRID XPO1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID YAP1 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification association, physical 24255178 , 24366813 , 25751139 , 25796446 , (Europe PMC )0.64 BioGRID, IntAct YLPM1 Affinity Capture-MS, Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 22321011 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.61 BioGRID, IntAct YWHAH Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ZBTB11 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct ZFYVE16 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 15231748 , 26186194 , 27880917 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZFYVE9 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 15231748 , 22321011 , 26186194 , 27880917 , 28514442 , (Europe PMC )0.55 BioGRID, IntAct, MINT ZNF326 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID ZNF827 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AATK Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 22321011 , 25852190 , 28065597 , (Europe PMC )0.55 BioGRID, IntAct ADH1B anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct AKT1 Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, fluorescence microscopy, phosphatase assay colocalization, dephosphorylation reaction, physical, physical association 14645548 , 16186112 , 20186153 , (Europe PMC )0.57 BioGRID, IntAct, MINT ALDOA anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct ANLN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct APAF1 Affinity Capture-Western, anti bait coimmunoprecipitation, antibody array physical, physical association 17274640 , (Europe PMC )0.52 BioGRID, IntAct APOB anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct ARFGEF3 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct ARHGAP1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct ASF1A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ATAD3A proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct ATM Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct AURKB Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct AXIN1 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17318175 , (Europe PMC )0.52 BioGRID, IntAct, MINT BAD Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct BCAR1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct BCL2 Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct BCL2L1 Affinity Capture-Western, Reconstituted Complex, antibody array physical, physical association 12115603 , 17274640 , (Europe PMC )0.40 BioGRID, IntAct BHLHE40 two hybrid physical association 23555304 , (Europe PMC )0.37 IntAct BRCA1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 12438214 , 17511879 , 22990118 , 25056273 , (Europe PMC )0.52 BioGRID, IntAct BTBD10 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct C16orf96 pull down association 28330616 , (Europe PMC )0.35 IntAct C1QA Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct C1QC anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct C20orf27 Affinity Capture-MS, inference by socio-affinity scoring, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.64 BioGRID, IntAct CAMSAP3 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct CAPZA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CASC1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct CCDC181 two hybrid physical association 15231748 , (Europe PMC )0.37 IntAct, MINT CCDC8 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct CCDC85B Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct CCDC85C Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct CCT6A proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct CD2BP2 Affinity Capture-MS, Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 19389623 , 22365833 , 27880917 , 28561026 , (Europe PMC )0.59 BioGRID, IntAct, MINT CDC5L Affinity Capture-MS, Co-purification, anti bait coimmunoprecipitation, phosphatase assay association, dephosphorylation reaction, physical 11101529 , 20467437 , 22940584 , (Europe PMC )0.59 BioGRID, IntAct, MINT CDH1 Affinity Capture-Western, Proximity Label-MS, anti bait coimmunoprecipitation, antibody array physical, physical association 17274640 , 25468996 , (Europe PMC )0.52 BioGRID, IntAct CDK1 Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct CDK2 Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct CDK4 Affinity Capture-Western, Co-fractionation, antibody array physical, physical association 17274640 , 22939629 , (Europe PMC )0.40 BioGRID, IntAct CDK5 pull down direct interaction 11320080 , (Europe PMC )0.44 IntAct, MINT CENPE pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct CEP126 {ECO:0000303|PubMed:24867236, two hybrid physical association 22321011 , (Europe PMC )0.37 IntAct CEP170 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CEP192 far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct CHCHD3 far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct CHCHD6 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct CHERP proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct CKB Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CLCN2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CLTC Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CNP Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CNST Affinity Capture-MS, Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 19389623 , 22321011 , 26186194 , 28514442 , (Europe PMC )0.66 BioGRID, IntAct CNTN1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CRK Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CRYM anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct CSMD1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct CSNK2B Two-hybrid, two hybrid physical, physical association 23555304 , (Europe PMC )0.37 BioGRID, IntAct CSRNP1 Affinity Capture-MS, Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 22321011 , 25416956 , 26186194 , 28514442 , (Europe PMC )0.76 BioGRID, IntAct CSRNP2 Affinity Capture-MS, Two-hybrid, far western blotting, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid direct interaction, physical, physical association 15231748 , 19389623 , 25416956 , 26186194 , 28514442 , (Europe PMC )0.84 BioGRID, IntAct, MINT CSRNP3 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct CUL1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct CXXC1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct DARS anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct DBN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DCAF7 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , (Europe PMC )0.51 BioGRID, IntAct DCN anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct DCTN1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct DDX31 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct DEAF1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct DLD Affinity Capture-MS, anti bait coimmunoprecipitation, cross-linking study association, physical 25593058 , 29128334 , (Europe PMC )0.53 BioGRID, IntAct DLG2 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct DLG3 far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct DZIP3 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct ECH1 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct EEF1G anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct EGLN3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct EHD4 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct ELFN1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct ELFN2 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct ELL far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct EPB41L1 anti bait coimmunoprecipitation association 26575790 , (Europe PMC )0.35 IntAct ERBIN proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct ESR1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct ESR2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct FABP3 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct FARP1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct FILIP1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct FKBP15 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct FLII anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct FLNA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct FOXP3 anti bait coimmunoprecipitation physical association 23396208 , (Europe PMC )0.40 IntAct FRMPD4 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct FRYL anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct GLIPR1L2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct GOT2 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct GPATCH2 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct GPKOW Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT GPR12 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct GRB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21706016 , (Europe PMC )0.35 BioGRID, IntAct GRIA1 phosphatase assay dephosphorylation reaction 20305656 , (Europe PMC )0.44 IntAct GRPEL1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct GRXCR1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct GSK3B Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 12147701 , 23455922 , 27880917 , (Europe PMC )0.35 BioGRID, IntAct GYG1 Affinity Capture-MS, pull down association, physical 26186194 , 28330616 , (Europe PMC )0.35 BioGRID, IntAct GYS1 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct H2AFJ anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HADHA anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HADHB anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HEYL Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT HNRNPC anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HNRNPL anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HNRNPM anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HP anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HSD17B10 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct HSPA1L Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct HSPD1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HTR7 tandem affinity purification association 19486527 , (Europe PMC )0.35 IntAct HYDIN pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct IBTK Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct ILF2 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct ILF3 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct ILK anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct INF2 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct IQGAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ITPR3 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct JPH3 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KANK1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct KCNK10 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct KCTD20 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct KDM5B pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct KIF18A Affinity Capture-MS, Two-hybrid, inference by socio-affinity scoring, tandem affinity purification, two hybrid association, physical, physical association 15231748 , 26186194 , 27173435 , 27880917 , 28514442 , (Europe PMC )0.64 BioGRID, IntAct, MINT KNL1 pull down, two hybrid direct interaction, physical association 15231748 , 19389623 , (Europe PMC )0.59 IntAct, MINT LIMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LMTK3 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct LPIN1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct LPIN2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct LPIN3 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct LRPPRC anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct LRRK2 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, protein phosphatase assay, proximity ligation assay colocalization, dephosphorylation reaction, physical association 23937259 , (Europe PMC )0.65 IntAct MAFG Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct MAL2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct MAP1B pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct MAP3K3 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MAP4K4 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct MAPK1 phosphatase assay dephosphorylation reaction 12840032 , (Europe PMC )0.44 IntAct, MINT MAPK3 phosphatase assay dephosphorylation reaction 12840032 , (Europe PMC )0.44 IntAct, MINT MAPRE1 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , (Europe PMC )0.51 BioGRID, IntAct MAPRE2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MARF1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct MATR3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MAX antibody array physical association 17274640 , (Europe PMC )0.40 IntAct MB anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct MCM7 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct MDH1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct MDH2 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct MIIP Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct MPHOSPH10 Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , (Europe PMC )0.59 BioGRID, IntAct, MINT MTX2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MVP anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct MYC Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MYH6 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct MYH9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO18A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO19 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO1D pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct MYO5C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NDP Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct NEK2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct NEK9 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct NIFK pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct NINL Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct NOM1 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT NOP53 two hybrid physical association 22321011 , (Europe PMC )0.37 IntAct NUBPL anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct NUP153 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26186194 , 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct ORC5 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PABPC4 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PABPN1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PACS1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PARD3 proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PARD6B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PCDH11X pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PCIF1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PDE5A anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PDLIM5 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PDRG1 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct PEAK1 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct PFDN2 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 27880917 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct PFDN6 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 27880917 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct PFKM anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PGAM1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PHACTR3 Affinity Capture-Western, Far Western, Two-hybrid, pull down, two hybrid association, physical, physical association 12925532 , 22321011 , 28330616 , (Europe PMC )0.55 BioGRID, IntAct PHC1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PHGDH anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PHRF1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PIAS1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PIAS3 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PIH1D1 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct PKMYT1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PLCL2 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 15231748 , 26186194 , 27880917 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PLIN4 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct POLR2E Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct POLR3A Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct PPP1CB Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, inference by socio-affinity scoring association, physical, physical association 22939629 , 26186194 , 26344197 , 26496610 , 27173435 , 28514442 , (Europe PMC )0.51 BioGRID, IntAct PPP1CC Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 24366813 , 26186194 , 26344197 , 26496610 , 27173435 , 28330616 , 28514442 , (Europe PMC )0.81 BioGRID, IntAct PPP1R10 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 10637318 , 12574161 , 15231748 , 20516061 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.61 BioGRID, IntAct, MINT PPP1R11 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct PPP1R12A anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PPP1R12C anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PPP1R13B Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 15231748 , 21998301 , 22321011 , 24366813 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.89 BioGRID, IntAct, MINT PPP1R13L Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid association, physical, physical association 21998301 , 22321011 , 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.86 BioGRID, IntAct, MINT PPP1R15A Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, pull down, two hybrid association, physical, physical association 12016208 , 12724406 , 15231748 , 29109149 , (Europe PMC )0.61 BioGRID, IntAct, MINT PPP1R15B Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 15231748 , 21382349 , 22321011 , 28330616 , (Europe PMC )0.78 BioGRID, IntAct, MINT PPP1R16A Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PPP1R16B Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 28514442 , (Europe PMC )0.49 BioGRID, IntAct PPP1R18 Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 22321011 , 25593058 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.70 BioGRID, IntAct PPP1R2 Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, filter binding, inference by socio-affinity scoring, molecular sieving, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid, x ray scattering association, direct interaction, physical, physical association 10807923 , 20826336 , 22321011 , 25593058 , 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.94 BioGRID, IntAct, MINT PPP1R21 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PPP1R26 Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , (Europe PMC )0.59 BioGRID, IntAct, MINT PPP1R27 far western blotting, pull down, two hybrid array, two hybrid prey pooling approach direct interaction, physical association 19389623 , (Europe PMC )0.69 IntAct PPP1R2P3 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 25416956 , (Europe PMC )0.70 IntAct PPP1R32 Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 19389623 , 21382349 , (Europe PMC )0.66 BioGRID, IntAct PPP1R35 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PPP1R36 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PPP1R37 Affinity Capture-MS, Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, direct interaction, physical, physical association 15231748 , 19389623 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.73 BioGRID, IntAct, MINT PPP1R3B Affinity Capture-MS, Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 15231748 , 26186194 , (Europe PMC )0.62 BioGRID, IntAct, MINT PPP1R3C pull down, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical association 22321011 , 28330616 , (Europe PMC )0.71 IntAct PPP1R3D Affinity Capture-MS, Two-hybrid, pull down, two hybrid association, physical, physical association 22321011 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.55 BioGRID, IntAct PPP1R3E Two-hybrid, pull down, two hybrid association, physical, physical association 22321011 , 28330616 , (Europe PMC )0.55 BioGRID, IntAct PPP1R3G Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PPP1R7 Affinity Capture-MS, anti bait coimmunoprecipitation, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 25593058 , 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.79 BioGRID, IntAct PPP1R8 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, inference by socio-affinity scoring, ion exchange chromatography, isothermal titration calorimetry, molecular sieving, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach, x-ray crystallography association, direct interaction, physical, physical association 10637318 , 12788942 , 15231748 , 18842582 , 20516061 , 20671031 , 22365833 , 22939629 , 22940584 , 25593058 , 26186194 , 26344197 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.49, 0.69, 0.90 BioGRID, IntAct, MINT PPP1R9A Affinity Capture-MS, pull down association, physical 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct PPP1R9B Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid association, physical, physical association 10194355 , 15231748 , 19094064 , 22321011 , 25593058 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.75 BioGRID, IntAct, MINT PPP2R5C Affinity Capture-Western, Two-hybrid, two hybrid physical, physical association 25487150 , (Europe PMC )0.37 BioGRID, IntAct PPP2R5E Two-hybrid, two hybrid physical, physical association 23555304 , (Europe PMC )0.37 BioGRID, IntAct PQBP1 {ECO:0000303|PubMed:10332029, ECO:0000303|PubMed:11163963, inference by socio-affinity scoring, tandem affinity purification association, physical association 27173435 , (Europe PMC )0.51 IntAct PRDX1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PRELP anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PREX1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PREX2 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PRR16 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PTEN Affinity Capture-Western, anti bait coimmunoprecipitation, antibody array physical, physical association 17274640 , (Europe PMC )0.52 BioGRID, IntAct PURA anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PYGL pull down association 28330616 , (Europe PMC )0.35 IntAct RANBP9 Two-hybrid, two hybrid physical, physical association 21382349 , 22321011 , (Europe PMC )0.55 BioGRID, IntAct RASSF10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct RASSF7 Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical 24366813 , 26186194 , 28330616 , 28514442 , (Europe PMC )0.60 BioGRID, IntAct RASSF8 Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical 24366813 , 26186194 , 28330616 , 28514442 , (Europe PMC )0.60 BioGRID, IntAct RASSF9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct RB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, antibody array, coimmunoprecipitation, pull down, two hybrid direct interaction, physical, physical association 12434308 , 17008050 , 17274640 , 8384581 , (Europe PMC )0.77 BioGRID, IntAct, MINT RBM26 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct RDX anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct RIF1 inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid association, physical association 22321011 , 27173435 , 28330616 , (Europe PMC )0.77 IntAct RIMBP2 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct RORC Two-hybrid, two hybrid physical, physical association 23555304 , (Europe PMC )0.37 BioGRID, IntAct RPAP3 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 17643375 , 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct RPGRIP1L pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct RPRD2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct RRP1B Affinity Capture-MS, Reconstituted Complex, pull down, tandem affinity purification association, direct interaction, physical 10637318 , 19389623 , 19710015 , (Europe PMC )0.35, 0.44 BioGRID, IntAct RUVBL1 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct RUVBL2 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 17643375 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct RYR1 phosphatase assay dephosphorylation reaction 18755143 , (Europe PMC )0.44 IntAct, MINT SACS pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct SEC31A anti bait coimmunoprecipitation physical association 25593058 , (Europe PMC )0.40 IntAct SERPINA1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct SF3A2 Affinity Capture-MS, affinity chromatography technology physical, physical association 17332742 , (Europe PMC )0.40 BioGRID, IntAct, MINT SF3B1 genetic interference, phosphatase assay dephosphorylation reaction, genetic interaction 18842582 , 22940584 , (Europe PMC )0.17, 0.44 IntAct, MINT SFI1 far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct SGO2 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association 21666598 , (Europe PMC )0.46 IntAct, MINT SH2D4A Affinity Capture-MS, far western blotting, pull down direct interaction, physical, physical association 19389623 , 28514442 , (Europe PMC )0.54 BioGRID, IntAct SH3RF2 Affinity Capture-Western, Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 19389623 , 19945436 , 22321011 , (Europe PMC )0.66 BioGRID, IntAct SKP1 Affinity Capture-Western, anti bait coimmunoprecipitation, antibody array physical, physical association 17274640 , (Europe PMC )0.52 BioGRID, IntAct SLC45A1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct SLC7A14 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct SMTNL2 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct SNCAIP Co-localization, Two-hybrid, two hybrid physical, physical association 22321011 , 24902662 , (Europe PMC )0.37 BioGRID, IntAct SNW1 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT SORL1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct SPATA2 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct SPOCD1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct SPRED1 Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , 22321011 , (Europe PMC )0.74 BioGRID, IntAct, MINT SRL anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct STAM Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT STAT3 genetic interference genetic interaction 19440292 , (Europe PMC )0.17 IntAct, MINT STAU1 Affinity Capture-Western, Two-hybrid, two hybrid physical, physical association 15231748 , 15303970 , 22321011 , (Europe PMC )0.55 BioGRID, IntAct, MINT SUCLA2 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct SYNPO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYTL2 Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , (Europe PMC )0.59 BioGRID, IntAct, MINT TCTEX1D4 Two-hybrid, two hybrid physical, physical association 21382349 , (Europe PMC )0.37 BioGRID, IntAct TF anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct TGFB1I1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct TMEM132C pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct TMEM132D far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct TMEM225 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct TOE1 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT TOR1AIP1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct TOX4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, proximity-dependent biotin identification, pull down association, physical 20516061 , 27880917 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct TP53 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT TP53BP2 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 15231748 , 21189257 , 21998301 , 22321011 , 24366813 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.86 BioGRID, IntAct, MINT TPRN Affinity Capture-MS, Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 15231748 , 22321011 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.49, 0.61 BioGRID, IntAct TRIM42 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct TRPC4AP far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct TSC2 far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct TSKS pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct TUBA1A pull down association 27291054 , (Europe PMC )0.35 IntAct TUSC3 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBE2Z Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct UBN1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct ULK1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct URI1 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27780869 , 27880917 , 28330616 , 28514442 , 28561026 , (Europe PMC )0.69 BioGRID, IntAct USP28 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct UXT Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct VAT1L anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct VCP anti bait coimmunoprecipitation association, physical association 25593058 , (Europe PMC )0.50 IntAct VPS54 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct WBP11 Affinity Capture-MS, Two-hybrid, inference by socio-affinity scoring, tandem affinity purification, two hybrid association, physical, physical association 22321011 , 22365833 , 26186194 , 27173435 , 27880917 , 28514442 , (Europe PMC )0.73 BioGRID, IntAct, MINT WDR81 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct WDR82 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, proximity-dependent biotin identification, pull down association, physical 20516061 , 27880917 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct WDR92 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , 28561026 , (Europe PMC )0.69 BioGRID, IntAct WNK1 far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct YAP1 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification association, physical 24255178 , 24366813 , 25751139 , 25796446 , (Europe PMC )0.64 BioGRID, IntAct YBX3 anti bait coimmunoprecipitation, fluorescence microscopy association, colocalization, physical association 25593058 , (Europe PMC )0.54 IntAct YLPM1 Affinity Capture-MS, Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 22321011 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.61 BioGRID, IntAct YWHAE anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct ZBTB11 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct ZBTB38 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct ZCCHC9 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct ZFYVE1 far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct ZFYVE16 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 15231748 , 26186194 , 27880917 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZFYVE9 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 15231748 , 22321011 , 26186194 , 27880917 , 28514442 , (Europe PMC )0.55 BioGRID, IntAct, MINT ZMIZ1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct ZNF827 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct ZSWIM3 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AKT1 Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, fluorescence microscopy, phosphatase assay colocalization, dephosphorylation reaction, physical, physical association 14645548 , 16186112 , 20186153 , (Europe PMC )0.57 BioGRID, IntAct, MINT AXIN1 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17318175 , (Europe PMC )0.52 BioGRID, IntAct, MINT CCDC181 two hybrid physical association 15231748 , (Europe PMC )0.37 IntAct, MINT CD2BP2 Affinity Capture-MS, Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 19389623 , 22365833 , 27880917 , 28561026 , (Europe PMC )0.59 BioGRID, IntAct, MINT CDC5L Affinity Capture-MS, Co-purification, anti bait coimmunoprecipitation, phosphatase assay association, dephosphorylation reaction, physical 11101529 , 20467437 , 22940584 , (Europe PMC )0.59 BioGRID, IntAct, MINT CDK5 pull down direct interaction 11320080 , (Europe PMC )0.44 IntAct, MINT CSRNP2 Affinity Capture-MS, Two-hybrid, far western blotting, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid direct interaction, physical, physical association 15231748 , 19389623 , 25416956 , 26186194 , 28514442 , (Europe PMC )0.84 BioGRID, IntAct, MINT GPKOW Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT HEYL Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KIF18A Affinity Capture-MS, Two-hybrid, inference by socio-affinity scoring, tandem affinity purification, two hybrid association, physical, physical association 15231748 , 26186194 , 27173435 , 27880917 , 28514442 , (Europe PMC )0.64 BioGRID, IntAct, MINT KNL1 pull down, two hybrid direct interaction, physical association 15231748 , 19389623 , (Europe PMC )0.59 IntAct, MINT MAPK1 phosphatase assay dephosphorylation reaction 12840032 , (Europe PMC )0.44 IntAct, MINT MAPK3 phosphatase assay dephosphorylation reaction 12840032 , (Europe PMC )0.44 IntAct, MINT MPHOSPH10 Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , (Europe PMC )0.59 BioGRID, IntAct, MINT NOM1 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT PLCL2 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 15231748 , 26186194 , 27880917 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT PPP1R10 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 10637318 , 12574161 , 15231748 , 20516061 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.61 BioGRID, IntAct, MINT PPP1R13B Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 15231748 , 21998301 , 22321011 , 24366813 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.89 BioGRID, IntAct, MINT PPP1R13L Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid association, physical, physical association 21998301 , 22321011 , 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.86 BioGRID, IntAct, MINT PPP1R15A Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, pull down, two hybrid association, physical, physical association 12016208 , 12724406 , 15231748 , 29109149 , (Europe PMC )0.61 BioGRID, IntAct, MINT PPP1R15B Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 15231748 , 21382349 , 22321011 , 28330616 , (Europe PMC )0.78 BioGRID, IntAct, MINT PPP1R2 Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, filter binding, inference by socio-affinity scoring, molecular sieving, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid, x ray scattering association, direct interaction, physical, physical association 10807923 , 20826336 , 22321011 , 25593058 , 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.94 BioGRID, IntAct, MINT PPP1R26 Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , (Europe PMC )0.59 BioGRID, IntAct, MINT PPP1R37 Affinity Capture-MS, Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, direct interaction, physical, physical association 15231748 , 19389623 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.73 BioGRID, IntAct, MINT PPP1R3B Affinity Capture-MS, Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 15231748 , 26186194 , (Europe PMC )0.62 BioGRID, IntAct, MINT PPP1R8 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, inference by socio-affinity scoring, ion exchange chromatography, isothermal titration calorimetry, molecular sieving, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach, x-ray crystallography association, direct interaction, physical, physical association 10637318 , 12788942 , 15231748 , 18842582 , 20516061 , 20671031 , 22365833 , 22939629 , 22940584 , 25593058 , 26186194 , 26344197 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.49, 0.69, 0.90 BioGRID, IntAct, MINT PPP1R9B Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid association, physical, physical association 10194355 , 15231748 , 19094064 , 22321011 , 25593058 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.75 BioGRID, IntAct, MINT RB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, antibody array, coimmunoprecipitation, pull down, two hybrid direct interaction, physical, physical association 12434308 , 17008050 , 17274640 , 8384581 , (Europe PMC )0.77 BioGRID, IntAct, MINT RYR1 phosphatase assay dephosphorylation reaction 18755143 , (Europe PMC )0.44 IntAct, MINT SF3A2 Affinity Capture-MS, affinity chromatography technology physical, physical association 17332742 , (Europe PMC )0.40 BioGRID, IntAct, MINT SF3B1 genetic interference, phosphatase assay dephosphorylation reaction, genetic interaction 18842582 , 22940584 , (Europe PMC )0.17, 0.44 IntAct, MINT SGO2 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association 21666598 , (Europe PMC )0.46 IntAct, MINT SNW1 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT SPRED1 Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , 22321011 , (Europe PMC )0.74 BioGRID, IntAct, MINT STAM Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT STAT3 genetic interference genetic interaction 19440292 , (Europe PMC )0.17 IntAct, MINT STAU1 Affinity Capture-Western, Two-hybrid, two hybrid physical, physical association 15231748 , 15303970 , 22321011 , (Europe PMC )0.55 BioGRID, IntAct, MINT SYTL2 Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , (Europe PMC )0.59 BioGRID, IntAct, MINT TOE1 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT TP53 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT TP53BP2 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 15231748 , 21189257 , 21998301 , 22321011 , 24366813 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.86 BioGRID, IntAct, MINT TUSC3 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT WBP11 Affinity Capture-MS, Two-hybrid, inference by socio-affinity scoring, tandem affinity purification, two hybrid association, physical, physical association 22321011 , 22365833 , 26186194 , 27173435 , 27880917 , 28514442 , (Europe PMC )0.73 BioGRID, IntAct, MINT ZFYVE16 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 15231748 , 26186194 , 27880917 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZFYVE9 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 15231748 , 22321011 , 26186194 , 27880917 , 28514442 , (Europe PMC )0.55 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AATK Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 22321011 , 25852190 , 28065597 , (Europe PMC )0.55 BioGRID, IntAct ACTA1 Affinity Capture-Western physical 15107502 , (Europe PMC )NA BioGRID ACTB Affinity Capture-MS, Co-fractionation physical 17683050 , 22939629 , (Europe PMC )NA BioGRID ADH1B anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct AKAP11 Affinity Capture-Western, Reconstituted Complex physical 10209101 , 12147701 , (Europe PMC )NA BioGRID AKT1 Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, fluorescence microscopy, phosphatase assay colocalization, dephosphorylation reaction, physical, physical association 14645548 , 16186112 , 20186153 , (Europe PMC )0.57 BioGRID, IntAct, MINT ALDH7A1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ALDOA anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct ANLN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct APAF1 Affinity Capture-Western, anti bait coimmunoprecipitation, antibody array physical, physical association 17274640 , (Europe PMC )0.52 BioGRID, IntAct APOB anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct AR Affinity Capture-Western physical 26636645 , (Europe PMC )NA BioGRID ARFGEF3 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct ARHGAP1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct ARNTL Affinity Capture-Western physical 23555304 , (Europe PMC )NA BioGRID ASF1A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ASNS Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ATAD3A proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct ATM Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct AURKA Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 11551964 , (Europe PMC )NA BioGRID AURKB Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct AXIN1 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 17318175 , (Europe PMC )0.52 BioGRID, IntAct, MINT BAD Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct BCAR1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct BCL2 Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct BCL2L1 Affinity Capture-Western, Reconstituted Complex, antibody array physical, physical association 12115603 , 17274640 , (Europe PMC )0.40 BioGRID, IntAct BCL2L2 Affinity Capture-Western, Reconstituted Complex physical 12115603 , (Europe PMC )NA BioGRID BHLHE40 two hybrid physical association 23555304 , (Europe PMC )0.37 IntAct BRAF Affinity Capture-MS physical 27034005 , (Europe PMC )NA BioGRID BRCA1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 12438214 , 17511879 , 22990118 , 25056273 , (Europe PMC )0.52 BioGRID, IntAct BTBD10 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct C12orf57 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID C16orf96 pull down association 28330616 , (Europe PMC )0.35 IntAct C1QA Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct C1QC anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct C20orf27 Affinity Capture-MS, inference by socio-affinity scoring, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.64 BioGRID, IntAct CAMSAP3 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct CAPNS1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID CAPZA2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CASC1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct CAV1 Affinity Capture-Western, Reconstituted Complex physical 14645548 , (Europe PMC )NA BioGRID CCDC181 Two-hybrid physical 15231748 , (Europe PMC )NA BioGRID CCDC181 two hybrid physical association 15231748 , (Europe PMC )0.37 IntAct, MINT CCDC6 Co-localization physical 20498639 , (Europe PMC )NA BioGRID CCDC8 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct CCDC85B Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct CCDC85C Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct CCNA1 Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID CCNB1 Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID CCND3 Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID CCT6A proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct CD2BP2 Affinity Capture-MS, Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 19389623 , 22365833 , 27880917 , 28561026 , (Europe PMC )0.59 BioGRID, IntAct, MINT CDC5L Affinity Capture-MS, Co-purification, anti bait coimmunoprecipitation, phosphatase assay association, dephosphorylation reaction, physical 11101529 , 20467437 , 22940584 , (Europe PMC )0.59 BioGRID, IntAct, MINT CDCA2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CDH1 Affinity Capture-Western, Proximity Label-MS, anti bait coimmunoprecipitation, antibody array physical, physical association 17274640 , 25468996 , (Europe PMC )0.52 BioGRID, IntAct CDK1 Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct CDK2 Affinity Capture-Western, antibody array physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct CDK4 Affinity Capture-Western, Co-fractionation, antibody array physical, physical association 17274640 , 22939629 , (Europe PMC )0.40 BioGRID, IntAct CDK5 pull down direct interaction 11320080 , (Europe PMC )0.44 IntAct, MINT CENPE pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct CEP126 Two-hybrid physical 22321011 , (Europe PMC )NA BioGRID CEP126 {ECO:0000303|PubMed:24867236, two hybrid physical association 22321011 , (Europe PMC )0.37 IntAct CEP170 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CEP192 far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct CHCHD3 far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct CHCHD6 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct CHERP proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct CHMP2A Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID CHUK Affinity Capture-Western physical 18949366 , (Europe PMC )NA BioGRID CKB Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CLCN2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CLOCK Affinity Capture-Luminescence, Affinity Capture-Western, Two-hybrid physical 23555304 , (Europe PMC )NA BioGRID CLTC Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CNP Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CNST Affinity Capture-MS, Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 19389623 , 22321011 , 26186194 , 28514442 , (Europe PMC )0.66 BioGRID, IntAct CNTN1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CREB1 Biochemical Activity physical 20498639 , (Europe PMC )NA BioGRID CRK Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct CRYM anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct CSMD1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct CSNK1E Biochemical Activity physical 17318175 , (Europe PMC )NA BioGRID CSNK2B Two-hybrid, two hybrid physical, physical association 23555304 , (Europe PMC )0.37 BioGRID, IntAct CSRNP1 Affinity Capture-MS, Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 22321011 , 25416956 , 26186194 , 28514442 , (Europe PMC )0.76 BioGRID, IntAct CSRNP2 Affinity Capture-MS, Two-hybrid, far western blotting, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid direct interaction, physical, physical association 15231748 , 19389623 , 25416956 , 26186194 , 28514442 , (Europe PMC )0.84 BioGRID, IntAct, MINT CSRNP3 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct CTDP1 Affinity Capture-Western physical 12036313 , (Europe PMC )NA BioGRID CUEDC2 Affinity Capture-Western physical 18362886 , (Europe PMC )NA BioGRID CUL1 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17274640 , (Europe PMC )0.40 BioGRID, IntAct CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CXXC1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct DARS anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct DBN1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct DCAF7 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , (Europe PMC )0.51 BioGRID, IntAct DCN anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct DCTN1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct DCX Affinity Capture-Western, Co-localization physical 19094064 , (Europe PMC )NA BioGRID DDX1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID DDX31 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct DEAF1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct DEC1 Two-hybrid physical 23555304 , (Europe PMC )NA BioGRID DLD Affinity Capture-MS, anti bait coimmunoprecipitation, cross-linking study association, physical 25593058 , 29128334 , (Europe PMC )0.53 BioGRID, IntAct DLG2 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct DLG3 far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct DPYSL2 Affinity Capture-MS physical 17683050 , (Europe PMC )NA BioGRID DZIP3 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct ECH1 anti tag coimmunoprecipitation association 29426014 , (Europe PMC )0.35 IntAct ECT2 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID EED Reconstituted Complex physical 12788942 , (Europe PMC )NA BioGRID EEF1G anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct EGLN3 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct EHD4 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct EIF2AK2 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 12138106 , (Europe PMC )NA BioGRID EIF2AK4 Affinity Capture-MS physical 26186194 , 27880917 , 28514442 , (Europe PMC )NA BioGRID ELFN1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct ELFN2 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct ELL far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct EPB41L1 anti bait coimmunoprecipitation association 26575790 , (Europe PMC )0.35 IntAct ERBIN Affinity Capture-MS physical 26186194 , 27880917 , 28514442 , (Europe PMC )NA BioGRID ERBIN proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct ESR1 Affinity Capture-MS, Reconstituted Complex, affinity chromatography technology association, physical 20348541 , 21182205 , (Europe PMC )0.35 BioGRID, IntAct ESR2 tandem affinity purification association 25604459 , (Europe PMC )0.35 IntAct FABP3 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct FARP1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct FILIP1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct FKBP15 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct FLII anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct FLNA Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct FN1 Affinity Capture-MS, cross-linking study association, physical 19738201 , (Europe PMC )0.35 BioGRID, IntAct FOXP3 anti bait coimmunoprecipitation physical association 23396208 , (Europe PMC )0.40 IntAct FRMPD4 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct FRYL anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct GLIPR1L2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct GOT2 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct GPATCH2 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct GPKOW Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT GPN3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GPR12 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct GRB2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21706016 , (Europe PMC )0.35 BioGRID, IntAct GRIA1 phosphatase assay dephosphorylation reaction 20305656 , (Europe PMC )0.44 IntAct GRPEL1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct GRXCR1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct GSK3A Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID GSK3B Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 12147701 , 23455922 , 27880917 , (Europe PMC )0.35 BioGRID, IntAct GYG1 Affinity Capture-MS, pull down association, physical 26186194 , 28330616 , (Europe PMC )0.35 BioGRID, IntAct GYS1 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct GYS2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID H2AFJ anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HADHA anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HADHB anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HCFC1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex physical 10637318 , 22939629 , (Europe PMC )NA BioGRID HDAC1 Affinity Capture-Western physical 16186112 , 17008050 , (Europe PMC )NA BioGRID HDAC3 Affinity Capture-Western physical 16186112 , (Europe PMC )NA BioGRID HDAC5 Affinity Capture-MS physical 21081666 , (Europe PMC )NA BioGRID HDAC6 Affinity Capture-Western physical 16186112 , (Europe PMC )NA BioGRID HEYL Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT HNRNPC anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HNRNPL anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HNRNPM anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HOMEZ Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HP anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HSD17B10 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct HSPA1L Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct HSPA4 Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS, Affinity Capture-Western physical 17683050 , 9269769 , (Europe PMC )NA BioGRID HSPD1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct HTR7 tandem affinity purification association 19486527 , (Europe PMC )0.35 IntAct HUWE1 Affinity Capture-MS physical 25147182 , (Europe PMC )NA BioGRID HYDIN pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct IBTK Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct IKBKB Affinity Capture-Western physical 18362886 , 18949366 , (Europe PMC )NA BioGRID ILF2 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct ILF3 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct ILK anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct INA Affinity Capture-MS physical 17683050 , (Europe PMC )NA BioGRID INF2 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct IQGAP1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID ITPR3 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct JPH3 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KANK1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct KCNK10 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct KCNQ1 Affinity Capture-Western, Reconstituted Complex physical 11799244 , (Europe PMC )NA BioGRID KCTD20 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct KDM5B pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KIF13B Affinity Capture-Western physical 19094064 , (Europe PMC )NA BioGRID KIF18A Affinity Capture-MS, Two-hybrid, inference by socio-affinity scoring, tandem affinity purification, two hybrid association, physical, physical association 15231748 , 26186194 , 27173435 , 27880917 , 28514442 , (Europe PMC )0.64 BioGRID, IntAct, MINT KIF1BP Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID KNL1 Affinity Capture-MS, Two-hybrid physical 15231748 , 26186194 , 27880917 , 28514442 , (Europe PMC )NA BioGRID KNL1 pull down, two hybrid direct interaction, physical association 15231748 , 19389623 , (Europe PMC )0.59 IntAct, MINT LATS1 Affinity Capture-Western physical 26116754 , (Europe PMC )NA BioGRID LBR Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID LEO1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID LIMA1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct LMTK2 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid physical 12393858 , 28065597 , (Europe PMC )NA BioGRID LMTK3 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct LNX1 Affinity Capture-MS physical 29121065 , (Europe PMC )NA BioGRID LPIN1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct LPIN2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct LPIN3 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct LRPPRC anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct LRRC1 Affinity Capture-MS physical 26186194 , 27880917 , 28514442 , (Europe PMC )NA BioGRID LRRK2 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, protein phosphatase assay, proximity ligation assay colocalization, dephosphorylation reaction, physical association 23937259 , (Europe PMC )0.65 IntAct MAFG Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct MAL2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct MAP1B pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct MAP3K3 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MAP4K4 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct MAPK1 phosphatase assay dephosphorylation reaction 12840032 , (Europe PMC )0.44 IntAct, MINT MAPK3 phosphatase assay dephosphorylation reaction 12840032 , (Europe PMC )0.44 IntAct, MINT MAPRE1 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , (Europe PMC )0.51 BioGRID, IntAct MAPRE2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MARF1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct MAT2B Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID MATR3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MAX Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID MAX antibody array physical association 17274640 , (Europe PMC )0.40 IntAct MB anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct MCM7 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct MDC1 Affinity Capture-MS physical 22990118 , (Europe PMC )NA BioGRID MDH1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct MDH2 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct MDM2 Affinity Capture-Western physical 26636645 , (Europe PMC )NA BioGRID MDM4 Affinity Capture-Western physical 23277204 , (Europe PMC )NA BioGRID MIIP Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct MKI67 Affinity Capture-MS physical 26186194 , 27880917 , 28514442 , (Europe PMC )NA BioGRID MPHOSPH10 Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , (Europe PMC )0.59 BioGRID, IntAct, MINT MST1R Affinity Capture-Western, Biochemical Activity physical 14505491 , (Europe PMC )NA BioGRID MTX2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MVP anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct MYC Affinity Capture-MS, tandem affinity purification association, physical 17314511 , (Europe PMC )0.35 BioGRID, IntAct MYH6 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct MYH9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO18A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO19 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID MYO19 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct MYO1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYO1D pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct MYO5C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct NCAM1 Reconstituted Complex physical 23061666 , (Europe PMC )NA BioGRID NCOR1 Affinity Capture-Western physical 12410313 , (Europe PMC )NA BioGRID NDP Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct NEK2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct NEK9 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct NFATC2 Affinity Capture-MS physical 27637333 , (Europe PMC )NA BioGRID NIFK pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct NINL Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct NOC2L Reconstituted Complex physical 10637318 , (Europe PMC )NA BioGRID NOM1 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT NONO Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 21566083 , (Europe PMC )NA BioGRID NOP53 Two-hybrid physical 22321011 , (Europe PMC )NA BioGRID NOP53 two hybrid physical association 22321011 , (Europe PMC )0.37 IntAct NR3C2 Affinity Capture-Western physical 28454724 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NUBPL anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct NUP153 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26186194 , 26496610 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID OGT Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID ORC5 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PABPC4 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PABPN1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PACS1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PAK1 Biochemical Activity physical 18586681 , (Europe PMC )NA BioGRID PARD3 Affinity Capture-Western physical 26116754 , (Europe PMC )NA BioGRID PARD3 proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PARD6B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PCDH11X pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PCIF1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PDE5A anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PDLIM5 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PDRG1 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct PEAK1 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct PFDN2 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 27880917 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct PFDN6 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 27880917 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct PFKM anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PGAM1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PHACTR1 Affinity Capture-Western, Two-hybrid physical 15107502 , (Europe PMC )NA BioGRID PHACTR3 Affinity Capture-Western, Far Western, Two-hybrid, pull down, two hybrid association, physical, physical association 12925532 , 22321011 , 28330616 , (Europe PMC )0.55 BioGRID, IntAct PHACTR4 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PHC1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PHGDH anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PHRF1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PIAS1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PIAS3 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PIH1D1 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct PKM Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PKMYT1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PLCL2 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 15231748 , 26186194 , 27880917 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PLIN4 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct POLR2A Biochemical Activity physical 12052871 , (Europe PMC )NA BioGRID POLR2E Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct POLR3A Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct POLR3B Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID POLR3E Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PPP1CB Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, inference by socio-affinity scoring association, physical, physical association 22939629 , 26186194 , 26344197 , 26496610 , 27173435 , 28514442 , (Europe PMC )0.51 BioGRID, IntAct PPP1CC Affinity Capture-MS, Co-fractionation, anti tag coimmunoprecipitation, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 24366813 , 26186194 , 26344197 , 26496610 , 27173435 , 28330616 , 28514442 , (Europe PMC )0.81 BioGRID, IntAct PPP1R10 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 10637318 , 12574161 , 15231748 , 20516061 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.61 BioGRID, IntAct, MINT PPP1R11 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct PPP1R12A anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PPP1R12C anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PPP1R13B Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 15231748 , 21998301 , 22321011 , 24366813 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.89 BioGRID, IntAct, MINT PPP1R13L Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid association, physical, physical association 21998301 , 22321011 , 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.86 BioGRID, IntAct, MINT PPP1R15A Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, pull down, two hybrid association, physical, physical association 12016208 , 12724406 , 15231748 , 29109149 , (Europe PMC )0.61 BioGRID, IntAct, MINT PPP1R15B Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 15231748 , 21382349 , 22321011 , 28330616 , (Europe PMC )0.78 BioGRID, IntAct, MINT PPP1R16A Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PPP1R16B Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 28514442 , (Europe PMC )0.49 BioGRID, IntAct PPP1R18 Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 22321011 , 25593058 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.70 BioGRID, IntAct PPP1R1B Affinity Capture-MS physical 17683050 , (Europe PMC )NA BioGRID PPP1R2 Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, filter binding, inference by socio-affinity scoring, molecular sieving, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid, x ray scattering association, direct interaction, physical, physical association 10807923 , 20826336 , 22321011 , 25593058 , 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.94 BioGRID, IntAct, MINT PPP1R21 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PPP1R26 Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , (Europe PMC )0.59 BioGRID, IntAct, MINT PPP1R27 far western blotting, pull down, two hybrid array, two hybrid prey pooling approach direct interaction, physical association 19389623 , (Europe PMC )0.69 IntAct PPP1R2B Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID PPP1R2P3 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 25416956 , (Europe PMC )0.70 IntAct PPP1R32 Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 19389623 , 21382349 , (Europe PMC )0.66 BioGRID, IntAct PPP1R35 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PPP1R36 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PPP1R37 Affinity Capture-MS, Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, direct interaction, physical, physical association 15231748 , 19389623 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.73 BioGRID, IntAct, MINT PPP1R3A Affinity Capture-MS physical 24366813 , (Europe PMC )NA BioGRID PPP1R3B Affinity Capture-MS, Two-hybrid, two hybrid, two hybrid array, two hybrid prey pooling approach physical, physical association 15231748 , 26186194 , (Europe PMC )0.62 BioGRID, IntAct, MINT PPP1R3C Two-hybrid physical 22321011 , (Europe PMC )NA BioGRID PPP1R3C pull down, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical association 22321011 , 28330616 , (Europe PMC )0.71 IntAct PPP1R3D Affinity Capture-MS, Two-hybrid, pull down, two hybrid association, physical, physical association 22321011 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.55 BioGRID, IntAct PPP1R3E Two-hybrid, pull down, two hybrid association, physical, physical association 22321011 , 28330616 , (Europe PMC )0.55 BioGRID, IntAct PPP1R3G Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PPP1R7 Affinity Capture-MS, anti bait coimmunoprecipitation, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 25593058 , 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.79 BioGRID, IntAct PPP1R8 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, inference by socio-affinity scoring, ion exchange chromatography, isothermal titration calorimetry, molecular sieving, nuclear magnetic resonance, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach, x-ray crystallography association, direct interaction, physical, physical association 10637318 , 12788942 , 15231748 , 18842582 , 20516061 , 20671031 , 22365833 , 22939629 , 22940584 , 25593058 , 26186194 , 26344197 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.49, 0.69, 0.90 BioGRID, IntAct, MINT PPP1R9A Affinity Capture-MS, pull down association, physical 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct PPP1R9B Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid association, physical, physical association 10194355 , 15231748 , 19094064 , 22321011 , 25593058 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.75 BioGRID, IntAct, MINT PPP2R5C Affinity Capture-Western, Two-hybrid, two hybrid physical, physical association 25487150 , (Europe PMC )0.37 BioGRID, IntAct PPP2R5D Affinity Capture-Western physical 25487150 , (Europe PMC )NA BioGRID PPP2R5E Two-hybrid, two hybrid physical, physical association 23555304 , (Europe PMC )0.37 BioGRID, IntAct PQBP1 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID PQBP1 {ECO:0000303|PubMed:10332029, ECO:0000303|PubMed:11163963, inference by socio-affinity scoring, tandem affinity purification association, physical association 27173435 , (Europe PMC )0.51 IntAct PRDX1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PRELP anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PREX1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PREX2 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct PRKAR1A Affinity Capture-Western physical 16582606 , (Europe PMC )NA BioGRID PRKCB Biochemical Activity physical 8749392 , (Europe PMC )NA BioGRID PRR16 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PTEN Affinity Capture-Western, anti bait coimmunoprecipitation, antibody array physical, physical association 17274640 , (Europe PMC )0.52 BioGRID, IntAct PTK2 Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID PTPA Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID PTPN7 Biochemical Activity physical 14613483 , (Europe PMC )NA BioGRID PURA anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct PYGL pull down association 28330616 , (Europe PMC )0.35 IntAct RANBP9 Two-hybrid, two hybrid physical, physical association 21382349 , 22321011 , (Europe PMC )0.55 BioGRID, IntAct RASSF10 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct RASSF7 Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical 24366813 , 26186194 , 28330616 , 28514442 , (Europe PMC )0.60 BioGRID, IntAct RASSF8 Affinity Capture-MS, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down association, physical 24366813 , 26186194 , 28330616 , 28514442 , (Europe PMC )0.60 BioGRID, IntAct RASSF9 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct RB1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, antibody array, coimmunoprecipitation, pull down, two hybrid direct interaction, physical, physical association 12434308 , 17008050 , 17274640 , 8384581 , (Europe PMC )0.77 BioGRID, IntAct, MINT RBM26 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct RDX anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct RIF1 Affinity Capture-MS, Two-hybrid physical 22321011 , 26186194 , 27173435 , 27880917 , 28514442 , (Europe PMC )NA BioGRID RIF1 inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification, two hybrid association, physical association 22321011 , 27173435 , 28330616 , (Europe PMC )0.77 IntAct RIMBP2 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct RORC Two-hybrid, two hybrid physical, physical association 23555304 , (Europe PMC )0.37 BioGRID, IntAct RPAP2 Affinity Capture-MS physical 17643375 , (Europe PMC )NA BioGRID RPAP3 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 17643375 , 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct RPGRIP1L pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct RPL13 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID RPRD2 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct RPS24 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RRP1B Affinity Capture-MS, Reconstituted Complex, pull down, tandem affinity purification association, direct interaction, physical 10637318 , 19389623 , 19710015 , (Europe PMC )0.35, 0.44 BioGRID, IntAct RUVBL1 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 26186194 , 28330616 , 28514442 , (Europe PMC )0.46 BioGRID, IntAct RUVBL2 Affinity Capture-MS, proximity-dependent biotin identification, pull down association, physical 17643375 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct RYR1 phosphatase assay dephosphorylation reaction 18755143 , (Europe PMC )0.44 IntAct, MINT RYR2 Co-fractionation physical 10830164 , (Europe PMC )NA BioGRID SACS pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct SCPEP1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID SCRIB Affinity Capture-MS physical 26186194 , 27880917 , 28514442 , (Europe PMC )NA BioGRID SEC31A anti bait coimmunoprecipitation physical association 25593058 , (Europe PMC )0.40 IntAct SERPINA1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct SF3A2 Affinity Capture-MS, affinity chromatography technology physical, physical association 17332742 , (Europe PMC )0.40 BioGRID, IntAct, MINT SF3B1 genetic interference, phosphatase assay dephosphorylation reaction, genetic interaction 18842582 , 22940584 , (Europe PMC )0.17, 0.44 IntAct, MINT SFI1 far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct SFPQ Affinity Capture-Western, Biochemical Activity physical 21566083 , (Europe PMC )NA BioGRID SFRP1 Affinity Capture-Western, Two-hybrid physical 17123353 , 21382349 , (Europe PMC )NA BioGRID SFRP2 Affinity Capture-Western physical 17123353 , (Europe PMC )NA BioGRID SFRP5 Affinity Capture-Western physical 17123353 , (Europe PMC )NA BioGRID SGO2 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association 21666598 , (Europe PMC )0.46 IntAct, MINT SH2D4A Affinity Capture-MS, far western blotting, pull down direct interaction, physical, physical association 19389623 , 28514442 , (Europe PMC )0.54 BioGRID, IntAct SH3RF2 Affinity Capture-Western, Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 19389623 , 19945436 , 22321011 , (Europe PMC )0.66 BioGRID, IntAct SHOC2 Affinity Capture-MS physical 26186194 , 27880917 , 28514442 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-MS physical 22586326 , (Europe PMC )NA BioGRID SKP1 Affinity Capture-Western, anti bait coimmunoprecipitation, antibody array physical, physical association 17274640 , (Europe PMC )0.52 BioGRID, IntAct SKP2 Affinity Capture-Western physical 26636645 , (Europe PMC )NA BioGRID SLC45A1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct SLC7A14 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct SMARCA5 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SMARCB1 Affinity Capture-Western, Phenotypic Enhancement, Reconstituted Complex genetic, physical 12016208 , (Europe PMC )NA BioGRID SMTNL2 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct SNCAIP Co-localization, Two-hybrid, two hybrid physical, physical association 22321011 , 24902662 , (Europe PMC )0.37 BioGRID, IntAct SNW1 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT SON Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SORL1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct SPATA2 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct SPOCD1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct SPRED1 Two-hybrid, far western blotting, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , 22321011 , (Europe PMC )0.74 BioGRID, IntAct, MINT SRL anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct SRSF11 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SRSF5 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SRSF7 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID STAM Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT STAT3 genetic interference genetic interaction 19440292 , (Europe PMC )0.17 IntAct, MINT STAU1 Affinity Capture-Western, Two-hybrid, two hybrid physical, physical association 15231748 , 15303970 , 22321011 , (Europe PMC )0.55 BioGRID, IntAct, MINT STK24 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID STX1A Affinity Capture-Western physical 17274640 , (Europe PMC )NA BioGRID SUCLA2 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct SUPT6H Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SYNCRIP Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SYNPO Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SYTL2 Two-hybrid, pull down, two hybrid direct interaction, physical, physical association 15231748 , 19389623 , (Europe PMC )0.59 BioGRID, IntAct, MINT TANC2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TBCB Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TCTEX1D4 Two-hybrid, two hybrid physical, physical association 21382349 , (Europe PMC )0.37 BioGRID, IntAct TERF2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID TES Affinity Capture-MS physical 28378594 , (Europe PMC )NA BioGRID TF anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct TFG Affinity Capture-MS physical 17683050 , (Europe PMC )NA BioGRID TGFB1I1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct TMEM132C pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct TMEM132D far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct TMEM225 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct TMOD3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TNFRSF1A Affinity Capture-Western physical 18949366 , (Europe PMC )NA BioGRID TOE1 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT TOR1AIP1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct TOX4 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, proximity-dependent biotin identification, pull down association, physical 20516061 , 27880917 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct TP53 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT TP53BP2 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 15231748 , 21189257 , 21998301 , 22321011 , 24366813 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.86 BioGRID, IntAct, MINT TPBG Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TPRN Affinity Capture-MS, Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 15231748 , 22321011 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.49, 0.61 BioGRID, IntAct TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRIM28 Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex physical 20424263 , (Europe PMC )NA BioGRID TRIM42 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct TRPC4AP far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct TSC2 far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct TSKS pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct TUBA1A pull down association 27291054 , (Europe PMC )0.35 IntAct TUSC3 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBE2Z Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct UBN1 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct UBXN2A Affinity Capture-MS physical 26389662 , (Europe PMC )NA BioGRID UBXN2B Affinity Capture-MS physical 26389662 , (Europe PMC )NA BioGRID ULK1 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct URI1 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27780869 , 27880917 , 28330616 , 28514442 , 28561026 , (Europe PMC )0.69 BioGRID, IntAct USP28 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct UXT Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.69 BioGRID, IntAct VAT1L anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct VCP anti bait coimmunoprecipitation association, physical association 25593058 , (Europe PMC )0.50 IntAct VPS54 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct VTN Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID WBP11 Affinity Capture-MS, Two-hybrid, inference by socio-affinity scoring, tandem affinity purification, two hybrid association, physical, physical association 22321011 , 22365833 , 26186194 , 27173435 , 27880917 , 28514442 , (Europe PMC )0.73 BioGRID, IntAct, MINT WDR81 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct WDR82 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, proximity-dependent biotin identification, pull down association, physical 20516061 , 27880917 , 28330616 , (Europe PMC )0.46 BioGRID, IntAct WDR92 Affinity Capture-MS, inference by socio-affinity scoring, proximity-dependent biotin identification, pull down, tandem affinity purification association, physical, physical association 26186194 , 27173435 , 27880917 , 28330616 , 28514442 , 28561026 , (Europe PMC )0.69 BioGRID, IntAct WNK1 far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct WWOX Affinity Capture-MS physical 24550385 , (Europe PMC )NA BioGRID WWTR1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity physical 21189257 , 26116754 , (Europe PMC )NA BioGRID XPO1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID YAP1 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, tandem affinity purification association, physical 24255178 , 24366813 , 25751139 , 25796446 , (Europe PMC )0.64 BioGRID, IntAct YBX3 anti bait coimmunoprecipitation, fluorescence microscopy association, colocalization, physical association 25593058 , (Europe PMC )0.54 IntAct YLPM1 Affinity Capture-MS, Two-hybrid, proximity-dependent biotin identification, pull down, two hybrid association, physical, physical association 22321011 , 26186194 , 27880917 , 28330616 , 28514442 , (Europe PMC )0.61 BioGRID, IntAct YWHAE anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct YWHAH Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ZBTB11 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct ZBTB38 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct ZCCHC9 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct ZFYVE1 far western blotting, pull down direct interaction, physical association 19389623 , (Europe PMC )0.54 IntAct ZFYVE16 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 15231748 , 26186194 , 27880917 , 28514442 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZFYVE9 Affinity Capture-MS, Two-hybrid, two hybrid physical, physical association 15231748 , 22321011 , 26186194 , 27880917 , 28514442 , (Europe PMC )0.55 BioGRID, IntAct, MINT ZMIZ1 anti bait coimmunoprecipitation association 25593058 , (Europe PMC )0.35 IntAct ZNF326 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID ZNF827 Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct ZSWIM3 pull down direct interaction 19389623 , (Europe PMC )0.44 IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
AKT1 T320_NPGGRPItPPRNSAK , NA NA PhosphoSitePlus , CDK1 T320_NPGGRPItPPRNSAK , LTP 9122166 ,(Europe PMC )PhosphoELM , PhosphoSitePlus , CDK2 T320_NPGGRPItPPRNSAK , NA NA PhosphoSitePlus , CDK5 T320_NPGGRPItPPRNSAK , NA NA PhosphoSitePlus , CDK_group T320_NPGGRPItPPRNSAK , LTP 12202491 ,(Europe PMC )PhosphoELM , LMTK2 T320_NPGGRPItPPRNSAK , NA NA PhosphoSitePlus , Unknown S11_SEKLNLDsIIGRLLE , S22_RLLEVQGsRPGKNVQ , T276_APNYCGEtDNAGAMM , T320_NPGGRPItPPRNSAK , T331_NSAKAKKt , HTP, LTP, in vivo 10880350 , 18088087 , 18669648 , 20068231 ,(Europe PMC )HPRD, PhosphoELM ,