Top
PAG1
Localization (UniProt annotation) Cell membrane Note=Present in lipid rafts Function (UniProt annotation) Negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and FCER1 (high affinityimmunoglobulin epsilon receptor)-mediated signaling in mast cellsPromotes CSK activation and recruitment to lipid rafts, whichresults in LCK inhibition Inhibits immunological synapseformation by preventing dynamic arrangement of lipid raftproteins May be involved in cell adhesion signaling Catalytic Activity (UniProt annotation) N/A Protein Sequence MGPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVPSDKEMFSRSVTSLATDAPAS
SEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGME
GPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSV
NVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSV
NKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKA
TLGTNGHHGLVPKENDYESISDLQQGRDITRL
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
PAG1 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-180292 GAB1 signalosome. GAB1 is recruited to the activated EGFR indirectly, through GRB2. GAB1 acts as an adaptor protein that enables formation of an active PIK3, through recruitment of PIK3 regulatory subunit PIK3R1 (also known as PI3Kp85), which subsequently recruits PIK3 catalytic subunit PIK3CA (also known as PI3Kp110). PIK3, in complex with EGFR, GRB2 and GAB1, catalyzes phosphorylation of PIP2 and its conversion to PIP3, which leads to the activation of the AKT signaling R-HSA-202427 Phosphorylation of CD3 and TCR zeta chains. Prior to T cell receptor (TCR) stimulation, CD4/CD8 associated Lck remains seperated from the TCR and is maintained in an inactive state by the action of Csk. Csk phosphorylates the negative regulatory tyrosine of Lck and inactivates the Lck kinase domain. <p>Upon TCR stimulation, CD4/CD8 associated Lck co-localizes with the TCR leading to the phosphorylation of the CD3 and TCR subunit. Lck becomes activated by way of CD45-mediated dephosphorylation of negative regulatory tyrosine residues. The presence to PAG-bound Csk is further reduced via the dephosphorylation of PAG (step 1). <p>Lck is further activated by trans-autophosphorylation on the tyrosine residue on its activation loop (step 2). Active Lck further phosphorylates the tyrosine residues on CD3 chains. The signal-transducing CD3 delta/epsilon/gamma and TCR zeta chains contain a critical signaling motif known as the immunoreceptor tyrosine-based activation motif (ITAM). The two critical tyrosines of each ITAM motif are phosphorylated by Lck (step 3)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABL1 Affinity Capture-Western, Two-hybrid physical 9334312 , (Europe PMC )NA BioGRID ACBD7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID C1QL4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CCR1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CDH1 Proximity Label-MS physical 25468996 , (Europe PMC )NA BioGRID CLPB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CSK Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10790433 , 12665526 , 18070987 , 28514442 , (Europe PMC )0.62 BioGRID, IntAct, MINT CYP2S1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DUSP22 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FKBP11 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FYN Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, peptide array association, physical, physical association 10790433 , 18056706 , 23866081 , (Europe PMC )0.62 BioGRID, IntAct, MINT GJB7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GPR141 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GRB2 Reconstituted Complex physical 10790433 , (Europe PMC )NA BioGRID GSTK1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HOXB5 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LCK Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10790433 , 18070987 , (Europe PMC )0.35 BioGRID, IntAct, MINT LCP2 Reconstituted Complex physical 10790433 , (Europe PMC )NA BioGRID LYN Reconstituted Complex, anti bait coimmunoprecipitation association, physical, physical association 10790433 , 18070987 , 23866081 , (Europe PMC )0.64 BioGRID, IntAct, MINT MED21 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MTUS2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NCSTN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NTRK3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PAG1 Affinity Capture-Western physical 12665526 , (Europe PMC )NA BioGRID PCDHGC3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCK2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PMS1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PTPN6 Reconstituted Complex physical 10790433 , (Europe PMC )NA BioGRID RPS27 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID S1PR2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SERHL2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SHC1 Reconstituted Complex physical 10790433 , (Europe PMC )NA BioGRID SLC25A41 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SLC9A3R1 Affinity Capture-Western, Co-fractionation, Far Western, Two-hybrid, coimmunoprecipitation, two hybrid physical, physical association 11684085 , (Europe PMC )0.51 BioGRID, IntAct, MINT SYK Reconstituted Complex physical 10790433 , (Europe PMC )NA BioGRID TIGD5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM185A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID VAV1 Reconstituted Complex physical 10790433 , (Europe PMC )NA BioGRID ZAP70 Reconstituted Complex physical 10790433 , (Europe PMC )NA BioGRID ZNF517 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CRK anti bait coimmunoprecipitation association 18070987 , (Europe PMC )0.35 IntAct, MINT CSK Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10790433 , 12665526 , 18070987 , 28514442 , (Europe PMC )0.62 BioGRID, IntAct, MINT EGFR anti bait coimmunoprecipitation physical association 23866081 , (Europe PMC )0.40 IntAct FYN Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, peptide array association, physical, physical association 10790433 , 18056706 , 23866081 , (Europe PMC )0.62 BioGRID, IntAct, MINT LCK Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10790433 , 18070987 , (Europe PMC )0.35 BioGRID, IntAct, MINT LYN Reconstituted Complex, anti bait coimmunoprecipitation association, physical, physical association 10790433 , 18070987 , 23866081 , (Europe PMC )0.64 BioGRID, IntAct, MINT PRKCB anti bait coimmunoprecipitation physical association 23866081 , (Europe PMC )0.40 IntAct RACK1 anti bait coimmunoprecipitation physical association 23866081 , (Europe PMC )0.40 IntAct SLC9A3R1 Affinity Capture-Western, Co-fractionation, Far Western, Two-hybrid, coimmunoprecipitation, two hybrid physical, physical association 11684085 , (Europe PMC )0.51 BioGRID, IntAct, MINT SRC anti bait coimmunoprecipitation association 18070987 , (Europe PMC )0.35 IntAct, MINT STAT3 anti bait coimmunoprecipitation association, physical association 18070987 , (Europe PMC )0.50 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CRK anti bait coimmunoprecipitation association 18070987 , (Europe PMC )0.35 IntAct, MINT CSK Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10790433 , 12665526 , 18070987 , 28514442 , (Europe PMC )0.62 BioGRID, IntAct, MINT FYN Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, peptide array association, physical, physical association 10790433 , 18056706 , 23866081 , (Europe PMC )0.62 BioGRID, IntAct, MINT LCK Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10790433 , 18070987 , (Europe PMC )0.35 BioGRID, IntAct, MINT LYN Reconstituted Complex, anti bait coimmunoprecipitation association, physical, physical association 10790433 , 18070987 , 23866081 , (Europe PMC )0.64 BioGRID, IntAct, MINT SLC9A3R1 Affinity Capture-Western, Co-fractionation, Far Western, Two-hybrid, coimmunoprecipitation, two hybrid physical, physical association 11684085 , (Europe PMC )0.51 BioGRID, IntAct, MINT SRC anti bait coimmunoprecipitation association 18070987 , (Europe PMC )0.35 IntAct, MINT STAT3 anti bait coimmunoprecipitation association, physical association 18070987 , (Europe PMC )0.50 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABL1 Affinity Capture-Western, Two-hybrid physical 9334312 , (Europe PMC )NA BioGRID ACBD7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID C1QL4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CCR1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CDH1 Proximity Label-MS physical 25468996 , (Europe PMC )NA BioGRID CLPB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CRK anti bait coimmunoprecipitation association 18070987 , (Europe PMC )0.35 IntAct, MINT CSK Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10790433 , 12665526 , 18070987 , 28514442 , (Europe PMC )0.62 BioGRID, IntAct, MINT CYP2S1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DUSP22 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID EGFR anti bait coimmunoprecipitation physical association 23866081 , (Europe PMC )0.40 IntAct FKBP11 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FYN Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, peptide array association, physical, physical association 10790433 , 18056706 , 23866081 , (Europe PMC )0.62 BioGRID, IntAct, MINT GJB7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GPR141 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GRB2 Reconstituted Complex physical 10790433 , (Europe PMC )NA BioGRID GSTK1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HOXB5 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LCK Reconstituted Complex, anti bait coimmunoprecipitation association, physical 10790433 , 18070987 , (Europe PMC )0.35 BioGRID, IntAct, MINT LCP2 Reconstituted Complex physical 10790433 , (Europe PMC )NA BioGRID LYN Reconstituted Complex, anti bait coimmunoprecipitation association, physical, physical association 10790433 , 18070987 , 23866081 , (Europe PMC )0.64 BioGRID, IntAct, MINT MED21 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MTUS2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NCSTN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NTRK3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PAG1 Affinity Capture-Western physical 12665526 , (Europe PMC )NA BioGRID PCDHGC3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCK2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PMS1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PRKCB anti bait coimmunoprecipitation physical association 23866081 , (Europe PMC )0.40 IntAct PTPN6 Reconstituted Complex physical 10790433 , (Europe PMC )NA BioGRID RACK1 anti bait coimmunoprecipitation physical association 23866081 , (Europe PMC )0.40 IntAct RPS27 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID S1PR2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SERHL2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SHC1 Reconstituted Complex physical 10790433 , (Europe PMC )NA BioGRID SLC25A41 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SLC9A3R1 Affinity Capture-Western, Co-fractionation, Far Western, Two-hybrid, coimmunoprecipitation, two hybrid physical, physical association 11684085 , (Europe PMC )0.51 BioGRID, IntAct, MINT SRC anti bait coimmunoprecipitation association 18070987 , (Europe PMC )0.35 IntAct, MINT STAT3 anti bait coimmunoprecipitation association, physical association 18070987 , (Europe PMC )0.50 IntAct, MINT SYK Reconstituted Complex physical 10790433 , (Europe PMC )NA BioGRID TIGD5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM185A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID VAV1 Reconstituted Complex physical 10790433 , (Europe PMC )NA BioGRID ZAP70 Reconstituted Complex physical 10790433 , (Europe PMC )NA BioGRID ZNF517 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
SRC Y317_EEEISAMySSVNKPG , NA NA PhosphoSitePlus , Unknown S229_AEFAEYAsVDRNKKC , S239_RNKKCRQsVNVESIL , Y163_GLGMEGPyEVLKDSS , Y181_NMVEDCLyETVKEIK , Y227_GKAEFAEyASVDRNK , Y317_EEEISAMySSVNKPG , Y341_LTVPESTyTSIQGDP , Y359_PSSCNDLyATVKDFE , Y417_LVPKENDyESISDLQ , HTP, in vitro, in vivo 15144186 , 15659558 , 16497976 , 18083107 , 18452278 ,(Europe PMC )HPRD, PhosphoELM ,