Top
PACS1
Localization (UniProt annotation) Golgi apparatus, trans-Golgi network Note=Localizes in the perinuclearregion, probably the TGN Function (UniProt annotation) Coat protein that is involved in the localization oftrans-Golgi network (TGN) membrane proteins that contain acidiccluster sorting motifs Controls the endosome-to-Golgi traffickingof furin and mannose-6-phosphate receptor by connecting theacidic-cluster-containing cytoplasmic domain of these moleculeswith the adapter-protein complex-1 (AP-1) of endosomal clathrin-coated membrane pits Involved in HIV-1 nef-mediated removal ofMHC-I from the cell surface to the TGN Catalytic Activity (UniProt annotation) N/A Protein Sequence MAERGGAGGGPGGAGGGSGQRGSGVAQSPQQPPPQQQQQQPPQQPTPPKLAQATSSSSSTSAAAASSSSSSTSTSMAVAV
ASGSAPPGGPGPGRTPAPVQMNLYATWEVDRSSSSCVPRLFSLTLKKLVMLKEMDKDLNSVVIAVKLQGSKRILRSNEIV
LPASGLVETELQLTFSLQYPHFLKRDANKLQIMLQRRKRYKNRTILGYKTLAVGLINMAEVMQHPNEGALVLGLHSNVKD
VSVPVAEIKIYSLSSQPIDHEGIKSKLSDRSPDIDNYSEEEEESFSSEQEGSDDPLHGQDLFYEDEDLRKVKKTRRKLTS
TSAITRQPNIKQKFVALLKRFKVSDEVGFGLEHVSREQIREVEEDLDELYDSLEMYNPSDSGPEMEETESILSTPKPKLK
PFFEGMSQSSSQTEIGSLNSKGSLGKDTTSPMELAALEKIKSTWIKNQDDSLTETDTLEITDQDMFGDASTSLVVPEKVK
TPMKSSKTDLQGSASPSKVEGVHTPRQKRSTPLKERQLSKPLSERTNSSDSERSPDLGHSTQIPRKVVYDQLNQILVSDA
ALPENVILVNTTDWQGQYVAELLQDQRKPVVCTCSTVEVQAVLSALLTRIQRYCNCNSSMPRPVKVAAVGGQSYLSSILR
FFVKSLANKTSDWLGYMRFLIIPLGSHPVAKYLGSVDSKYSSSFLDSGWRDLFSRSEPPVSEQLDVAGRVMQYVNGAATT
HQLPVAEAMLTCRHKFPDEDSYQKFIPFIGVVKVGLVEDSPSTAGDGDDSPVVSLTVPSTSPPSSSGLSRDATATPPSSP
SMSSALAIVGSPNSPYGDVIGLQVDYWLGHPGERRREGDKRDASSKNTLKSVFRSVQVSRLPHSGEAQLSGTMAMTVVTK
EKNKKVPTIFLSKKPREKEVDSKSQVIEGISRLICSAKQQQTMLRVSIDGVEWSDIKFFQLAAQWPTHVKHFPVGLFSGS
KAT
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
PACS1 is dephosphorylated by following phosphatases:
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CSNK2A1 Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 16977309 , (Europe PMC )0.40 BioGRID, IntAct, MINT CTDSPL Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID FAAP100 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID FGFR1OP Affinity Capture-MS, tandem affinity purification physical, physical association 20360068 , (Europe PMC )0.40 BioGRID, IntAct FURIN Reconstituted Complex, Two-hybrid physical 9695949 , (Europe PMC )NA BioGRID GGA3 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down direct interaction, physical, physical association 16977309 , (Europe PMC )0.54 BioGRID, IntAct, MINT HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID IQCF1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID PPP1CA Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PPP1CB Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PPP1R7 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , (Europe PMC )0.51 BioGRID, IntAct PTPRG Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification physical, physical association 27173435 , (Europe PMC )0.53 BioGRID, IntAct SNX24 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SORL1 Affinity Capture-Western physical 17855360 , (Europe PMC )NA BioGRID VAMP4 Affinity Capture-Western physical 14608369 , (Europe PMC )NA BioGRID WDR37 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AP1G1 pull down direct interaction 16977309 , (Europe PMC )0.44 IntAct, MINT CSNK2A1 Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 16977309 , (Europe PMC )0.40 BioGRID, IntAct, MINT CSNK2B anti tag coimmunoprecipitation, pull down, two hybrid array direct interaction, physical association 16977309 , (Europe PMC )0.59 IntAct, MINT FGFR1OP Affinity Capture-MS, tandem affinity purification physical, physical association 20360068 , (Europe PMC )0.40 BioGRID, IntAct GABARAPL2 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GGA3 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down direct interaction, physical, physical association 16977309 , (Europe PMC )0.54 BioGRID, IntAct, MINT IGF2R pull down direct interaction 16977309 , (Europe PMC )0.44 IntAct, MINT PPP1CA Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PPP1CB Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PPP1R7 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , (Europe PMC )0.51 BioGRID, IntAct PTPRG Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification physical, physical association 27173435 , (Europe PMC )0.53 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AP1G1 pull down direct interaction 16977309 , (Europe PMC )0.44 IntAct, MINT CSNK2A1 Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 16977309 , (Europe PMC )0.40 BioGRID, IntAct, MINT CSNK2B anti tag coimmunoprecipitation, pull down, two hybrid array direct interaction, physical association 16977309 , (Europe PMC )0.59 IntAct, MINT GGA3 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down direct interaction, physical, physical association 16977309 , (Europe PMC )0.54 BioGRID, IntAct, MINT IGF2R pull down direct interaction 16977309 , (Europe PMC )0.44 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AP1G1 pull down direct interaction 16977309 , (Europe PMC )0.44 IntAct, MINT CSNK2A1 Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 16977309 , (Europe PMC )0.40 BioGRID, IntAct, MINT CSNK2B anti tag coimmunoprecipitation, pull down, two hybrid array direct interaction, physical association 16977309 , (Europe PMC )0.59 IntAct, MINT CTDSPL Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID FAAP100 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID FGFR1OP Affinity Capture-MS, tandem affinity purification physical, physical association 20360068 , (Europe PMC )0.40 BioGRID, IntAct FURIN Reconstituted Complex, Two-hybrid physical 9695949 , (Europe PMC )NA BioGRID GABARAPL2 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GGA3 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, pull down direct interaction, physical, physical association 16977309 , (Europe PMC )0.54 BioGRID, IntAct, MINT HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID IGF2R pull down direct interaction 16977309 , (Europe PMC )0.44 IntAct, MINT IQCF1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID PPP1CA Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PPP1CB Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct PPP1R7 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , (Europe PMC )0.51 BioGRID, IntAct PTPRG Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification physical, physical association 27173435 , (Europe PMC )0.53 BioGRID, IntAct SNX24 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SORL1 Affinity Capture-Western physical 17855360 , (Europe PMC )NA BioGRID VAMP4 Affinity Capture-Western physical 14608369 , (Europe PMC )NA BioGRID WDR37 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
CK2_group S278_SPDIDNYsEEEEESF , LTP 14633983 ,(Europe PMC )PhosphoELM , CSNK2A1 S278_SPDIDNYsEEEEESF , NA 14633983 , 16977309 ,(Europe PMC )HPRD, PhosphoSitePlus , Unknown S379_SLEMYNPsDSGPEME , S381_EMYNPSDsGPEMEET , S407_KPFFEGMsQSSSQTE , S410_FEGMSQSsSQTEIGS , S430_SLGKDTTsPMELAAL , S493_SKTDLQGsASPSKVE , S495_TDLQGSAsPSKVEGV , S497_LQGSASPsKVEGVHT , S528_PLSERTNsSDSERSP , S529_LSERTNSsDSERSPD , S531_ERTNSSDsERSPDLG , S534_NSSDSERsPDLGHST , T124_VPRLFSLtLKKLVML , T429_GSLGKDTtSPMELAA , T46_QQPPQQPtPPKLAQA , T504_SKVEGVHtPRQKRST , T526_SKPLSERtNSSDSER , Y251_PVAEIKIySLSSQPI , HTP, in vivo 15302935 , 17525332 , 18083107 , 18669648 , 18691976 , 19413330 , 19651622 , 20068231 , 20230923 ,(Europe PMC )HPRD, PhosphoELM ,