Top
NFU1
Localization (UniProt annotation) Mitochondrion Cytoplasm, cytosol Function (UniProt annotation) Iron-sulfur cluster scaffold protein which can assemble[4Fe-4S] clusters and deliver them to target proteins Catalytic Activity (UniProt annotation) N/A Protein Sequence MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPV
LETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGE
AGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQ
VMDDESDEKEANSP
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AGTRAP Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct CALCOCO2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct DUSP13 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID EPM2A Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12915448 , (Europe PMC )NA BioGRID HIRA Reconstituted Complex, Two-hybrid physical 11342215 , (Europe PMC )NA BioGRID HSPB1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SH3BP4 Two-hybrid, two hybrid physical, physical association 18654987 , (Europe PMC )0.37 BioGRID, IntAct TFIP11 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct TRIM23 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AGTRAP Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct CALCOCO2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct HSCB anti bait coimmunoprecipitation association 28380382 , (Europe PMC )0.35 IntAct HSPB1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NOA1 two hybrid pooling approach physical association 16169070 , (Europe PMC )0.37 IntAct SH3BP4 Two-hybrid, two hybrid physical, physical association 18654987 , (Europe PMC )0.37 BioGRID, IntAct TFIP11 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct TRIM23 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AGTRAP Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct CALCOCO2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct DUSP13 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID EPM2A Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 12915448 , (Europe PMC )NA BioGRID HIRA Reconstituted Complex, Two-hybrid physical 11342215 , (Europe PMC )NA BioGRID HSCB anti bait coimmunoprecipitation association 28380382 , (Europe PMC )0.35 IntAct HSPB1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NOA1 two hybrid pooling approach physical association 16169070 , (Europe PMC )0.37 IntAct SH3BP4 Two-hybrid, two hybrid physical, physical association 18654987 , (Europe PMC )0.37 BioGRID, IntAct TFIP11 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct TRIM23 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct