Top
MDM2
Localization (UniProt annotation) Nucleus, nucleoplasm Cytoplasm Nucleus,nucleolus Note=Expressed predominantly in the nucleoplasmInteraction with ARF(P14) results in the localization of bothproteins to the nucleolus The nucleolar localization signals inboth ARF(P14) and MDM2 may be necessary to allow efficientnucleolar localization of both proteins Colocalizes with RASSF1isoform A in the nucleus Function (UniProt annotation) E3 ubiquitin-protein ligase that mediates ubiquitinationof p53/TP53, leading to its degradation by the proteasomeInhibits p53/TP53- and p73/TP73-mediated cell cycle arrest andapoptosis by binding its transcriptional activation domain Alsoacts as a ubiquitin ligase E3 toward itself and ARRB1 Permits thenuclear export of p53/TP53 Promotes proteasome-dependentubiquitin-independent degradation of retinoblastoma RB1 proteinInhibits DAXX-mediated apoptosis by inducing its ubiquitinationand degradation Component of the TRIM28/KAP1-MDM2-p53/TP53complex involved in stabilizing p53/TP53 Also component of theTRIM28/KAP1-ERBB4-MDM2 complex which links growth factor and DNAdamage response pathways Mediates ubiquitination and subsequentproteasome degradation of DYRK2 in nucleus Ubiquitinates IGF1Rand SNAI1 and promotes them to proteasomal degradation(PubMed:12821780, PubMed:15053880, PubMed:15195100,PubMed:15632057, PubMed:16337594, PubMed:17290220,PubMed:19098711, PubMed:19219073, PubMed:19837670,PubMed:19965871, PubMed:20173098, PubMed:20385133,PubMed:20858735, PubMed:22128911) Ubiquitinates DCX, leading toDCX degradation and reduction of the dendritic spine density ofolfactory bulb granule cells (By similarity) Ubiquitinates DLG4,leading to proteasomal degradation of DLG4 which is required forAMPA receptor endocytosis (By similarity) Catalytic Activity (UniProt annotation) S-ubiquitinyl-[E2 ubiquitin-conjugatingenzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptorprotein]-L-lysine Protein Sequence MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSND
LLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSS
RRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCN
RCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTS
SSIIYSSQEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
MDM2 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa01522 Endocrine resistance Endocrine therapy is a key treatment strategy to control or eradicate hormone-responsive breast cancer. The most commonly used endocrine therapy agents are selective estrogen receptor modulators (SERMs, e.g. tamoxifen), estrogen synthesis inhibitors (e.g. aromatase inhibitors (AIs) such as anastrozole, letrozole, and exemestane), and selective estrogen receptor down-regulators (SERDs, e.g. fulvestrant). However, resistance to these agents has become a major clinical obstacle. Mechanisms of endocrine resistance include loss of ER-alpha expression, altered expression of coactivators or coregulators that play a critical role in ER-mediated gene transcription, ligand-independent growth factor signaling cascades that activate kinases and ER-phosphorylation, altered availability of active tamoxifen metabolites regulated by drug-metabolizing enzymes, such as CYP2D6, and deregulation of the cell cycle and apoptotic machinery. hsa01524 Platinum drug resistance Platinum-based drugs cisplatin, carboplatin and oxaliplatin are widely used in the therapy of solid malignancies, including testicular, ovarian, head and neck, colorectal, bladder and lung cancers. The mechanism of action of Platinum-based drugs involves covalent binding to purine DNA bases, which primarily leads to cellular apoptosis. Their clinical success is, however, limited due to severe side effects and intrinsic or acquired resistance to the treatment. Platinum resistance could arise from decreased drug influx, increased drug efflux, intracellular detoxification by glutathione, etc., decreased binding (e.g., due to high intracellular pH), increased DNA repair, decreased mismatch repair, defective apoptosis, and altered oncogene expression. hsa04068 FoxO signaling pathway The forkhead box O (FOXO) family of transcription factors regulates the expression of genes in cellular physiological events including apoptosis, cell-cycle control, glucose metabolism, oxidative stress resistance, and longevity. A central regulatory mechanism of FOXO proteins is phosphorylation by the serine-threonine kinase Akt/protein kinase B (Akt/PKB), downstream of phosphatidylinositol 3-kinase (PI3K), in response to insulin or several growth factors. Phosphorylation at three conserved residues results in the export of FOXO proteins from the nucleus to the cytoplasm, thereby decreasing expression of FOXO target genes. In contrast, the stress-activated c-Jun N-terminal kinase (JNK) and the energy sensing AMP-activated protein kinase (AMPK), upon oxidative and nutrient stress stimuli phosphorylate and activate FoxOs. Aside from PKB, JNK and AMPK, FOXOs are regulated by multiple players through several post-translational modifications, including phosphorylation, but also acetylation, methylation and ubiquitylation. hsa04110 Cell cycle Mitotic cell cycle progression is accomplished through a reproducible sequence of events, DNA replication (S phase) and mitosis (M phase) separated temporally by gaps known as G1 and G2 phases. Cyclin-dependent kinases (CDKs) are key regulatory enzymes, each consisting of a catalytic CDK subunit and an activating cyclin subunit. CDKs regulate the cell's progression through the phases of the cell cycle by modulating the activity of key substrates. Downstream targets of CDKs include transcription factor E2F and its regulator Rb. Precise activation and inactivation of CDKs at specific points in the cell cycle are required for orderly cell division. Cyclin-CDK inhibitors (CKIs), such as p16Ink4a, p15Ink4b, p27Kip1, and p21Cip1, are involved in the negative regulation of CDK activities, thus providing a pathway through which the cell cycle is negatively regulated.Eukaryotic cells respond to DNA damage by activating signaling pathways that promote cell cycle arrest and DNA repair. In response to DNA damage, the checkpoint kinase ATM phosphorylates and activates Chk2, which in turn directly phosphorylates and activates p53 tumor suppressor protein. p53 and its transcriptional targets play an important role in both G1 and G2 checkpoints. ATR-Chk1-mediated protein degradation of Cdc25A protein phosphatase is also a mechanism conferring intra-S-phase checkpoint activation. hsa04115 p53 signaling pathway p53 activation is induced by a number of stress signals, including DNA damage, oxidative stress and activated oncogenes. The p53 protein is employed as a transcriptional activator of p53-regulated genes. This results in three major outputs; cell cycle arrest, cellular senescence or apoptosis. Other p53-regulated gene functions communicate with adjacent cells, repair the damaged DNA or set up positive and negative feedback loops that enhance or attenuate the functions of the p53 protein and integrate these stress responses with other signal transduction pathways. hsa04120 Ubiquitin mediated proteolysis Protein ubiquitination plays an important role in eukaryotic cellular processes. It mainly functions as a signal for 26S proteasome dependent protein degradation. The addition of ubiquitin to proteins being degraded is performed by a reaction cascade consisting of three enzymes, named E1 (ubiquitin activating enzyme), E2 (ubiquitin conjugating enzyme), and E3 (ubiquitin ligase). Each E3 has specificity to its substrate, or proteins to be targeted by ubiquitination. Many E3s are discovered in eukaryotes and they are classified into four types: HECT type, U-box type, single RING-finger type, and multi-subunit RING-finger type. Multi-subunit RING-finger E3s are exemplified by cullin-Rbx E3s and APC/C. They consist of a RING-finger-containing subunit (RBX1 or RBX2) that functions to bind E2s, a scaffold-like cullin molecule, adaptor proteins, and a target recognizing subunit that binds substrates. hsa04144 Endocytosis Endocytosis is a mechanism for cells to remove ligands, nutrients, and plasma membrane (PM) proteins, and lipids from the cell surface, bringing them into the cell interior. Transmembrane proteins entering through clathrin-dependent endocytosis (CDE) have sequences in their cytoplasmic domains that bind to the APs (adaptor-related protein complexes) and enable their rapid removal from the PM. In addition to APs and clathrin, there are numerous accessory proteins including dynamin. Depending on the various proteins that enter the endosome membrane, these cargoes are sorted to distinct destinations. Some cargoes, such as nutrient receptors, are recycled back to the PM. Ubiquitylated membrane proteins, such as activated growth-factor receptors, are sorted into intraluminal vesicles and eventually end up in the lysosome lumen via multivesicular endosomes (MVEs). There are distinct mechanisms of clathrin-independent endocytosis (CIE) depending upon the cargo and the cell type. hsa04151 PI3K-Akt signaling pathway The phosphatidylinositol 3' -kinase(PI3K)-Akt signaling pathway is activated by many types of cellular stimuli or toxic insults and regulates fundamental cellular functions such as transcription, translation, proliferation, growth, and survival. The binding of growth factors to their receptor tyrosine kinase (RTK) or G protein-coupled receptors (GPCR) stimulates class Ia and Ib PI3K isoforms, respectively. PI3K catalyzes the production of phosphatidylinositol-3,4,5-triphosphate (PIP3) at the cell membrane. PIP3 in turn serves as a second messenger that helps to activate Akt. Once active, Akt can control key cellular processes by phosphorylating substrates involved in apoptosis, protein synthesis, metabolism, and cell cycle. hsa04218 Cellular senescence Cellular senescence is a state of irreversible cellular arrest and can be triggered by a number of factors, such as telomere shortening, oncogene activation, irradiation, DNA damage and oxidative stress. It is characterized by enlarged flattened morphology, senescence-associated beta-galactosidase (SA-b-gal) activity, secretion of inflammatory cytokines, growth factors and matrix metalloproteinases, as part of the senescence-associated secretory phenotype (SASP). Cellular senescence is functionally associated with many biological processes including aging, tumor suppression, placental biology, embryonic development, and wound healing. hsa04625 C-type lectin receptor signaling pathway C-type lectin receptors (CLRs) are a large superfamily of proteins characterized by the presence of one or more C-type lectin-like domains (CTLDs). CLRs function as pattern-recognition receptors (PRRs) for pathogen-derived ligands in dendric cells, macrophages, neutrophils, etc., such as Dectin-1 and Dectin-2 for recognition of fungi-derived B-glucan and high mannose-type carbohydrates. Upon ligand binding, CLRs stimulate intracellular signaling cascades that induce the production of inflammatory cytokines and chemokines, consequently triggering innate and adaptive immunity to pathogens. hsa04919 Thyroid hormone signaling pathway The thyroid hormones (THs) are important regulators of growth, development and metabolism. The action of TH is mainly mediated by T3 (3,5,3'-triiodo-L-thyronine). Thyroid hormones, L-thyroxine (T4) and T3 enter the cell through transporter proteins. Although the major form of TH in the blood is T4, it is converted to the more active hormone T3 within cells. T3 binds to nuclear thyroid hormone receptors (TRs), which functions as a ligand-dependent transcription factor and controls the expression of target genes (genomic action). Nongenomic mechanisms of action is initiated at the integrin receptor. The plasma membrane alpha(v)beta(3)-integrin has distinct binding sites for T3 and T4. One binding site binds only T3 and activates the phosphatidylinositol 3-kinase (PI3K) pathway. The other binding site binds both T3 and T4 and activates the ERK1/2 MAP kinase pathway. hsa05163 Human cytomegalovirus infection Human cytomegalovirus (HCMV) is an enveloped, double-stranded DNA virus that is a member of beta-herpesvirus family. HCMV is best known for causing significant morbidity and mortality in immunocompromised populations. As with other herpesviruses, HCMV gB and gH/gL envelope glycoproteins are essential for virus entry. HCMV gB could activate the PDGFRA, and induce activation of the oncogenic PI3-K/AKT pathway. Though it is unlikely that HCMV by itself can act as an oncogenic factor, HCMV may have an oncomodulatory role, to catalyze an oncogenic process that has already been initiated. US28, one of the four HCMV-encoded vGPCRs (US27, US28, UL33 and UL78), also has a specific role in the oncomodulatory properties. In addition, HCMV has developed numerous mechanisms for manipulating the host immune system. The virally encoded US2, US3, US6 and US11 gene products all interfere with major histocompatibility complex (MHC) class I antigen presentation. HCMV encodes several immediate early (IE) antiapoptotic proteins (IE1, IE2, vMIA and vICA). These proteins might avoid immune clearance of infected tumor cells by cytotoxic lymphocytes and NK cells. hsa05165 Human papillomavirus infection Human papillomavirus (HPV) is a non-enveloped, double-stranded DNA virus. HPV infect mucoal and cutaneous epithelium resulting in several types of pathologies, most notably, cervical cancer. All types of HPV share a common genomic structure and encode eight proteins: E1, E2, E4, E5, E6, and E7 (early) and L1 and L2 (late). It has been demonstrated that E1 and E2 are involved in viral transcription and replication. The functions of the E4 protein is not yet fully understood. E5, E6, and E7 act as oncoproteins. E5 inhibits the V-ATPase, prolonging EGFR signaling and thereby promoting cell proliferation. The expression of E6 and E7 not only inhibits the tumor suppressors p53 and Rb, but also alters additional signalling pathways. Among these pathways, PI3K/Akt signalling cascade plays a very important role in HPV-induced carcinogenesis. The L1 and L2 proteins form icosahedral capsids for progeny virion generation. hsa05169 Epstein-Barr virus infection Epstein-Barr virus (EBV) is a gamma-herpes virus that widely infects human populations predominantly at an early age but remains mostly asymptomatic. EBV has been linked to a wide spectrum of human malignancies, including nasopharyngeal carcinoma and other hematologic cancers, like Hodgkin's lymphoma, Burkitt's lymphoma (BL), B-cell immunoblastic lymphoma in HIV patients, and posttransplant-associated lymphoproliferative diseases. EBV has the unique ability to establish life-long latent infection in primary human B lymphocytes. During latent infection, EBV expresses a small subset of genes, including 6 nuclear antigens (EBNA-1, -2, -3A, -3B, -3C, and -LP), 3 latent membrane proteins (LMP-1, -2A, and -2B), 2 small noncoding RNAs (EBER-1 and 2). On the basis of these latent gene expression, three different latency patterns associated with the types of cancers are recognized. hsa05200 Pathways in cancer hsa05202 Transcriptional misregulation in cancer In tumor cells, genes encoding transcription factors (TFs) are often amplified, deleted, rearranged via chromosomal translocation and inversion, or subjected to point mutations that result in a gain- or loss-of- function. In hematopoietic cancers and solid tumors, the translocations and inversions increase or deregulate transcription of the oncogene. Recurrent chromosome translocations generate novel fusion oncoproteins, which are common in myeloid cancers and soft-tissue sarcomas. The fusion proteins have aberrant transcriptional function compared to their wild-type counterparts. These fusion transcription factors alter expression of target genes, and thereby result in a variety of altered cellular properties that contribute to the tumourigenic process. hsa05203 Viral carcinogenesis There is a strong association between viruses and the development of human malignancies. We now know that at least six human viruses, Epstein-Barr virus (EBV), hepatitis B virus (HBV), hepatitis C virus (HCV), human papilloma virus (HPV), human T-cell lymphotropic virus (HTLV-1) and Kaposi's associated sarcoma virus (KSHV) contribute to 10-15% of the cancers worldwide. Via expression of many potent oncoproteins, these tumor viruses promote an aberrant cell-proliferation via modulating cellular cell-signaling pathways and escape from cellular defense system such as blocking apoptosis. Human tumor virus oncoproteins can also disrupt pathways that are necessary for the maintenance of the integrity of host cellular genome. Viruses that encode such activities can contribute to initiation as well as progression of human cancers. hsa05205 Proteoglycans in cancer Many proteoglycans (PGs) in the tumor microenvironment have been shown to be key macromolecules that contribute to biology of various types of cancer including proliferation, adhesion, angiogenesis and metastasis, affecting tumor progress. The four main types of proteoglycans include hyaluronan (HA), which does not occur as a PG but in free form, heparan sulfate proteoglycans (HSPGs), chondroitin sulfate proteoglycans (CSPGs), dematan sulfate proteoglycans (DSPG) and keratan sulfate proteoglycans (KSPGs) [BR:00535]. Among these proteoglycans such as HA, acting with CD44, promotes tumor cell growth and migration, whereas other proteoglycans such as syndecans (-1~-4), glypican (-1, -3) and perlecan may interact with growth factors, cytokines, morphogens and enzymes through HS chains [BR: 00536], also leading to tumor growth and invasion. In contrast, some of the small leucine-rich proteolgycans, such as decorin and lumican, can function as tumor repressors, and modulate the signaling pathways by the interaction of their core proteins and multiple receptors. hsa05206 MicroRNAs in cancer MicroRNA (miRNA) is a cluster of small non-encoding RNA molecules of 21 - 23 nucleotides in length, which controls gene expression post-transcriptionally either via the degradation of target mRNAs or the inhibition of protein translation. Using high-throughput profiling, dysregulation of miRNAs has been widely observed in different stages of cancer. The upregulation (overexpression) of specific miRNAs could lead to the repression of tumor suppressor gene expression, and conversely the downregulation of specific miRNAs could result in an increase of oncogene expression; both these situations induce subsequent malignant effects on cell proliferation, differentiation, and apoptosis that lead to tumor growth and progress. The miRNA signatures of cancer observed in various studies differ significantly. These inconsistencies occur due to the differences in the study populations and methodologies used. This pathway map shows the summarized results from various studies in 9 cancers, each of which is presented in a review article. hsa05214 Glioma Gliomas are the most common of the primary brain tumors and account for more than 40% of all central nervous system neoplasms. Gliomas include tumours that are composed predominantly of astrocytes (astrocytomas), oligodendrocytes (oligodendrogliomas), mixtures of various glial cells (for example,oligoastrocytomas) and ependymal cells (ependymomas). The most malignant form of infiltrating astrocytoma - glioblastoma multiforme (GBM) - is one of the most aggressive human cancers. GBM may develop de novo (primary glioblastoma) or by progression from low-grade or anaplastic astrocytoma (secondary glioblastoma). Primary glioblastomas develop in older patients and typically show genetic alterations (EGFR amplification, p16/INK4a deletion, and PTEN mutations) at frequencies of 24-34%. Secondary glioblastomas develop in younger patients and frequently show overexpression of PDGF and CDK4 as well as p53 mutations (65%) and loss of Rb playing major roles in such transformations. Loss of PTEN has been implicated in both pathways, although it is much more common in the pathogenesis of primary GBM. hsa05215 Prostate cancer Prostate cancer constitutes a major health problem in Western countries. It is the most frequently diagnosed cancer among men and the second leading cause of male cancer deaths. The identification of key molecular alterations in prostate-cancer cells implicates carcinogen defenses (GSTP1), growth-factor-signaling pathways (NKX3.1, PTEN, and p27), and androgens (AR) as critical determinants of the phenotype of prostate-cancer cells. Glutathione S-transferases (GSTP1) are detoxifying enzymes. Cells of prostatic intraepithelial neoplasia, devoid of GSTP1, undergo genomic damage mediated by carcinogens. NKX3.1, PTEN, and p27 regulate the growth and survival of prostate cells in the normal prostate. Inadequate levels of PTEN and NKX3.1 lead to a reduction in p27 levels and to increased proliferation and decreased apoptosis. Androgen receptor (AR) is a transcription factor that is normally activated by its androgen ligand. During androgen withdrawal therapy, the AR signal transduction pathway also could be activated by amplification of the AR gene, by AR gene mutations, or by altered activity of AR coactivators. Through these mechanisms, tumor cells lead to the emergence of androgen-independent prostate cancer. hsa05218 Melanoma Melanoma is a form of skin cancer that has a poor prognosis and which is on the rise in Western populations. Melanoma arises from the malignant transformation of pigment-producing cells, melanocytes. The only known environmental risk factor is exposure to ultraviolet (UV) light and in people with fair skin the risk is greatly increased. Melanoma pathogenesis is also driven by genetic factors. Oncogenic NRAS mutations activate both effector pathways Raf-MEK-ERK and PI3K-Akt. The Raf-MEK-ERK pathway may also be activated via mutations in the BRAF gene. The PI3K-Akt pathway may be activated through loss or mutation of the inhibitory tumor suppressor gene PTEN. These mutations arise early during melanoma pathogenesis and are preserved throughout tumor progression. Melanoma development has been shown to be strongly associated with inactivation of the p16INK4a/cyclin dependent kinases 4 and 6/retinoblastoma protein (p16INK4a/CDK4,6/pRb) and p14ARF/human double minute 2/p53 (p14ARF/HMD2/p53) tumor suppressor pathways. MITF and TP53 are implicated in further melanoma progression. hsa05219 Bladder cancer The urothelium covers the luminal surface of almost the entire urinary tract, extending from the renal pelvis, through the ureter and bladder, to the proximal urethra. The majority of urothelial carcinoma are bladder carcinomas, and urothelial carcinomas of the renal pelvis and ureter account for only approximately 7% of the total. Urothelial tumours arise and evolve through divergent phenotypic pathways. Some tumours progress from urothelial hyperplasia to low-grade non-invasive superficial papillary tumours. More aggressive variants arise either from flat, high-grade carcinoma in situ (CIS) and progress to invasive tumours, or they arise de novo as invasive tumours. Low-grade papillary tumors frequently show a constitutive activation of the receptor tyrosine kinase-Ras pathway, exhibiting activating mutations in the HRAS and fibroblast growth factor receptor 3 (FGFR3) genes. In contrast, CIS and invasive tumors frequently show alterations in the TP53 and RB genes and pathways. Invasion and metastases are promoted by several factors that alter the tumour microenvironment, including the aberrant expression of E-cadherins (E-cad), matrix metalloproteinases (MMPs), angiogenic factors such as vascular endothelial growth factor (VEGF). hsa05220 Chronic myeloid leukemia Chronic myeloid leukemia (CML) is a clonal myeloproliferative disorder of a pluripotent stem cell. The natural history of CML has a triphasic clinical course comprising of an initial chronic phase (CP), which is characterized by expansion of functionally normal myeloid cells, followed by an accelerated phase (AP) and finally a more aggressive blast phase (BP), with loss of terminal differentiation capacity. On the cellular level, CML is associated with a specific chromosome abnormality, the t(9; 22) reciprocal translocation that forms the Philadelphia (Ph) chromosome. The Ph chromosome is the result of a molecular rearrangement between the c-ABL proto-oncogene on chromosome 9 and the BCR (breakpoint cluster region) gene on chromosome 22. The BCR/ABL fusion gene encodes p210 BCR/ABL, an oncoprotein, which, unlike the normal p145 c-Abl, has constitutive tyrosine kinase activity and is predominantly localized in the cytoplasm. While fusion of c-ABL and BCR is believed to be the primary cause of the chronic phase of CML, progression to blast crisis requires other molecular changes. Common secondary abnormalities include mutations in TP53, RB, and p16/INK4A, or overexpression of genes such as EVI1. Additional chromosome translocations are also observed,such as t(3;21)(q26;q22), which generates AML1-EVI1.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-198323 AKT phosphorylates targets in the cytosol. Following activation, AKT can phosphorylate an array of target proteins in the cytoplasm, many of which are involved in cell survival control. Phosphorylation of TSC2 feeds positively to the TOR kinase, which, in turn, contributes to AKT activation (positive feedback loop) R-HSA-2559580 Oxidative Stress Induced Senescence. Oxidative stress, caused by increased concentration of reactive oxygen species (ROS) in the cell, can happen as a consequence of mitochondrial dysfunction induced by the oncogenic RAS (Moiseeva et al. 2009) or independent of oncogenic signaling. Prolonged exposure to interferon-beta (IFNB, IFN-beta) also results in ROS increase (Moiseeva et al. 2006). ROS oxidize thioredoxin (TXN), which causes TXN to dissociate from the N-terminus of MAP3K5 (ASK1), enabling MAP3K5 to become catalytically active (Saitoh et al. 1998). ROS also stimulate expression of Ste20 family kinases MINK1 (MINK) and TNIK through an unknown mechanism, and MINK1 and TNIK positively regulate MAP3K5 activation (Nicke et al. 2005).<p> MAP3K5 phosphorylates and activates MAP2K3 (MKK3) and MAP2K6 (MKK6) (Ichijo et al. 1997, Takekawa et al. 2005), which act as p38 MAPK kinases, as well as MAP2K4 (SEK1) (Ichijo et al. 1997, Matsuura et al. 2002), which, together with MAP2K7 (MKK7), acts as a JNK kinase.<p> MKK3 and MKK6 phosphorylate and activate p38 MAPK alpha (MAPK14) and beta (MAPK11) (Raingeaud et al. 1996), enabling p38 MAPKs to phosphorylate and activate MAPKAPK2 (MK2) and MAPKAPK3 (MK3) (Ben-Levy et al. 1995, Clifton et al. 1996, McLaughlin et al. 1996, Sithanandam et al. 1996, Meng et al. 2002, Lukas et al. 2004, White et al. 2007), as well as MAPKAPK5 (PRAK) (New et al. 1998 and 2003, Sun et al. 2007).<p> Phosphorylation of JNKs (MAPK8, MAPK9 and MAPK10) by MAP3K5-activated MAP2K4 (Deacon and Blank 1997, Fleming et al. 2000) allows JNKs to migrate to the nucleus (Mizukami et al. 1997) where they phosphorylate JUN. Phosphorylated JUN binds FOS phosphorylated by ERK1 or ERK2, downstream of activated RAS (Okazaki and Sagata 1995, Murphy et al. 2002), forming the activated protein 1 (AP-1) complex (FOS:JUN heterodimer) (Glover and Harrison 1995, Ainbinder et al. 1997). <p> Activation of p38 MAPKs and JNKs downstream of MAP3K5 (ASK1) ultimately converges on transcriptional regulation of CDKN2A locus. In dividing cells, nucleosomes bound to the CDKN2A locus are trimethylated on lysine residue 28 of histone H3 (HIST1H3A) by the Polycomb repressor complex 2 (PRC2), creating the H3K27Me3 (Me3K-28-HIST1H3A) mark (Bracken et al. 2007, Kotake et al. 2007). The expression of Polycomb constituents of PRC2 (Kuzmichev et al. 2002) - EZH2, EED and SUZ12 - and thereby formation of the PRC2, is positively regulated in growing cells by E2F1, E2F2 and E2F3 (Weinmann et al. 2001, Bracken et al. 2003). H3K27Me3 mark serves as a docking site for the Polycomb repressor complex 1 (PRC1) that contains BMI1 (PCGF4) and is therefore named PRC1.4, leading to the repression of transcription of p16-INK4A and p14-ARF from the CDKN2A locus, where PCR1.4 mediated repression of p14-ARF transcription in humans may be context dependent (Voncken et al. 2005, Dietrich et al. 2007, Agherbi et al. 2009, Gao et al. 2012). MAPKAPK2 and MAPKAPK3, activated downstream of the MAP3K5-p38 MAPK cascade, phosphorylate BMI1 of the PRC1.4 complex, leading to dissociation of PRC1.4 complex from the CDKN2A locus and upregulation of p14-ARF transcription (Voncken et al. 2005). AP-1 transcription factor, formed as a result of MAP3K5-JNK signaling, as well as RAS signaling, binds the promoter of KDM6B (JMJD3) gene and stimulates KDM6B expression. KDM6B is a histone demethylase that removes H3K27Me3 mark i.e. demethylates lysine K28 of HIST1H3A, thereby preventing PRC1.4 binding to the CDKN2A locus and allowing transcription of p16-INK4A (Agger et al. 2009, Barradas et al. 2009, Lin et al. 2012).<p> p16-INK4A inhibits phosphorylation-mediated inactivation of RB family members by CDK4 and CDK6, leading to cell cycle arrest (Serrano et al. 1993). p14-ARF inhibits MDM2-mediated degradation of TP53 (p53) (Zhang et al. 1998), which also contributes to cell cycle arrest in cells undergoing oxidative stress. In addition, phosphorylation of TP53 by MAPKAPK5 (PRAK) activated downstream of MAP3K5-p38 MAPK signaling, activates TP53 and contributes to cellular senescence (Sun et al. 2007) R-HSA-2559585 Oncogene Induced Senescence. Oncogene-induced senescence is triggered by high level of RAS/RAF/MAPK signaling that can be caused, for example, by oncogenic mutations in RAS or RAF proteins, or by oncogenic mutations in growth factor receptors, such as EGFR, that act upstream of RAS/RAF/MAPK cascade. Oncogene-induced senescence can also be triggered by high transcriptional activity of E2F1, E2F2 or E2F3 which can be caused, for example, by the loss-of-function of RB1 tumor suppressor.Oncogenic signals trigger transcription of CDKN2A locus tumor suppressor genes: p16-INK4A and p14-ARF. p16-INK4A and p14-ARF share exons 2 and 3, but are expressed from different promoters and use different reading frames (Quelle et al. 1995). Therefore, while their mRNAs are homologous and are both translationally inhibited by miR-24 microRNA (Lal et al. 2008, To et al. 2012), they share no similarity at the amino acid sequence level and perform distinct functions in the cell. p16-INK4A acts as the inhibitor of cyclin-dependent kinases CDK4 and CDK6 which phosphorylate and inhibit RB1 protein thereby promoting G1 to S transition and cell cycle progression (Serrano et al. 1993). Increased p16-INK4A level leads to hypophosphorylation of RB1, allowing RB1 to inhibit transcription of E2F1, E2F2 and E2F3-target genes that are needed for cell cycle progression, which results in cell cycle arrest in G1 phase. p14-ARF binds and destabilizes MDM2 ubiquitin ligase (Zhang et al. 1998), responsible for ubiquitination and degradation of TP53 (p53) tumor suppressor protein (Wu et al. 1993, Fuchs et al. 1998, Fang et al. 2000). Therefore, increased p14-ARF level leads to increased level of TP53 and increased expression of TP53 target genes, such as p21, which triggers p53-mediated cell cycle arrest and, depending on other factors, may also lead to p53-mediated apoptosis. CDKN2B locus, which encodes an inhibitor of CDK4 and CDK6, p15-INK4B, is located in the vicinity of CDKN2A locus, at the chromosome band 9p21. p15-INK4B, together with p16-INK4A, contributes to senescence of human T-lymphocytes (Erickson et al. 1998) and mouse fibroblasts (Malumbres et al. 2000). SMAD3, activated by TGF-beta-1 signaling, controls senescence in the mouse multistage carcinogenesis model through regulation of MYC and p15-INK4B gene expression (Vijayachandra et al. 2003). TGF-beta-induced p15-INK4B expression is also important for the senescence of hepatocellular carcinoma cell lines (Senturk et al. 2010).<p>MAP kinases MAPK1 (ERK2) and MAPK3 (ERK1), which are activated by RAS signaling, phosphorylate ETS1 and ETS2 transcription factors in the nucleus (Yang et al. 1996, Seidel et al. 2002, Foulds et al. 2004, Nelson et al. 2010). Phosphorylated ETS1 and ETS2 are able to bind RAS response elements (RREs) in the CDKN2A locus and stimulate p16-INK4A transcription (Ohtani et al. 2004). At the same time, activated ERKs (MAPK1 i.e. ERK2 and MAPK3 i.e. ERK1) phosphorylate ERF, the repressor of ETS2 transcription, which leads to translocation of ERF to the cytosol and increased transcription of ETS2 (Sgouras et al. 1995, Le Gallic et al. 2004). ETS2 can be sequestered and inhibited by binding to ID1, resulting in inhibition of p16-INK4A transcription (Ohtani et al. 2004).Transcription of p14-ARF is stimulated by binding of E2F transcription factors (E2F1, E2F2 or E2F3) in complex with SP1 to p14-ARF promoter (Parisi et al. 2002).Oncogenic RAS signaling affects mitochondrial metabolism through an unknown mechanism, leading to increased generation of reactive oxygen species (ROS), which triggers oxidative stress induced senescence pathway. In addition, increased rate of cell division that is one of the consequences of oncogenic signaling, leads to telomere shortening which acts as another senescence trigger R-HSA-3232118 SUMOylation of transcription factors. Proteins classified as transcription factors constitute a disproportionate number of SUMOylation targets. In most cases SUMOylation inhibits transcriptional activation, however in some cases such as TP53 (p53) SUMOylation can enhance activation. Inhibition of transcription by SUMOylation may be due to interference with DNA binding, re-localization to inactive nuclear bodies, or recruitment of repressive cofactors such as histone deacetylases (reviewed in Girdwood et al. 2004, Gill 2005) R-HSA-3232142 SUMOylation of ubiquitinylation proteins. Several ubiquitin E3 ligases are regulated by SUMOylation (reviewed in Wilson and Heaton 2008). SUMOylation appears to be necessary for nuclear import of MDM2, the E3 ligase that ubiquitinylates TP53 (p53). SUMOylation of VHL abolishes its ubiquitin ligase activity. HERC2, RNF168, and BRCA1 are ubiquitin ligases that are SUMOylated during DNA damage response and repair R-HSA-399719 Trafficking of AMPA receptors. Repetitive presynaptic activity causes long lasting changes in the postsynaptic transmission by changing the type and the number of AMPA receptors. These changes are brought about by trafficking mechanisms that are mainly controlled by activity dependent phosphorylation/desphosphorylation of the GluR1/GluR2 subunits R-HSA-5674400 Constitutive Signaling by AKT1 E17K in Cancer. While AKT1 gene copy number, expression level and phosphorylation are often increased in cancer, only one low frequency point mutation has been repeatedly reported in cancer and functionally studied. This mutation represents a substitution of a glutamic acid residue with lysine at position 17 of AKT1, and acts by enabling AKT1 to bind PIP2. PIP2-bound AKT1 is phosphorylated by TORC2 complex and by PDPK1 that is always present at the plasma membrane, due to low affinity for PIP2. Therefore, E17K substitution abrogates the need for PI3K in AKT1 activation (Carpten et al. 2007, Landgraf et al. 2008) R-HSA-5689880 Ub-specific processing proteases. Ub-specific processing proteases (USPs) are the largest of the DUB families with more than 50 members in humans. The USP catalytic domain varies considerably in size and consists of six conserved motifs with N- or C-terminal extensions and insertions occurring between the conserved motifs (Ye et al. 2009). Two highly conserved regions comprise the catalytic triad, the Cys-box (Cys) and His-box (His and Asp/Asn) (Nijman et al. 2005, Ye et al. 2009, Reyes-Turcu & Wilkinson 2009). They recognize their substrates by interactions of the variable regions with the substrate protein directly, or via scaffolds or adapters in multiprotein complexes R-HSA-6804756 Regulation of TP53 Activity through Phosphorylation. Phosphorylation of TP53 (p53) at the N-terminal serine residues S15 and S20 plays a critical role in protein stabilization as phosphorylation at these sites interferes with binding of the ubiquitin ligase MDM2 to TP53. Several different kinases can phosphorylate TP53 at S15 and S20. In response to double strand DNA breaks, S15 is phosphorylated by ATM (Banin et al. 1998, Canman et al. 1998, Khanna et al. 1998), and S20 by CHEK2 (Chehab et al. 1999, Chehab et al. 2000, Hirao et al. 2000). DNA damage or other types of genotoxic stress, such as stalled replication forks, can trigger ATR-mediated phosphorylation of TP53 at S15 (Lakin et al. 1999, Tibbetts et al. 1999) and CHEK1-mediated phosphorylation of TP53 at S20 (Shieh et al. 2000). In response to various types of cell stress, NUAK1 (Hou et al. 2011), CDK5 (Zhang et al. 2002, Lee et al. 2007, Lee et al. 2008), AMPK (Jones et al. 2005) and TP53RK (Abe et al. 2001, Facchin et al. 2003) can phosphorylate TP53 at S15, while PLK3 (Xie, Wang et al. 2001, Xie, Wu et al. 2001) can phosphorylate TP53 at S20.<p>Phosphorylation of TP53 at serine residue S46 promotes transcription of TP53-regulated apoptotic genes rather than cell cycle arrest genes. Several kinases can phosphorylate S46 of TP53, including ATM-activated DYRK2, which, like TP53, is targeted for degradation by MDM2 (Taira et al. 2007, Taira et al. 2010). TP53 is also phosphorylated at S46 by HIPK2 in the presence of the TP53 transcriptional target TP53INP1 (D'Orazi et al. 2002, Hofmann et al. 2002, Tomasini et al. 2003). CDK5, in addition to phosphorylating TP53 at S15, also phosphorylates it at S33 and S46, which promotes neuronal cell death (Lee et al. 2007).<p>MAPKAPK5 (PRAK) phosphorylates TP53 at serine residue S37, promoting cell cycle arrest and cellular senescence in response to oncogenic RAS signaling (Sun et al. 2007).<p>NUAK1 phosphorylates TP53 at S15 and S392, and phosphorylation at S392 may contribute to TP53-mediated transcriptional activation of cell cycle arrest genes (Hou et al. 2011). S392 of TP53 is also phosphorylated by the complex of casein kinase II (CK2) bound to the FACT complex, enhancing transcriptional activity of TP53 in response to UV irradiation (Keller et al. 2001, Keller and Lu 2002).<p>The activity of TP53 is inhibited by phosphorylation at serine residue S315, which enhances MDM2 binding and degradation of TP53. S315 of TP53 is phosphorylated by Aurora kinase A (AURKA) (Katayama et al. 2004) and CDK2 (Luciani et al. 2000). Interaction with MDM2 and the consequent TP53 degradation is also increased by phosphorylation of TP53 threonine residue T55 by the transcription initiation factor complex TFIID (Li et al. 2004).<p>Aurora kinase B (AURKB) has been shown to phosphorylate TP53 at serine residue S269 and threonine residue T284, which is possibly facilitated by the binding of the NIR co-repressor. AURKB-mediated phosphorylation was reported to inhibit TP53 transcriptional activity through an unknown mechanism (Wu et al. 2011). A putative direct interaction between TP53 and AURKB has also been described and linked to TP53 phosphorylation and S183, T211 and S215 and TP53 degradation (Gully et al. 2012) R-HSA-6804757 Regulation of TP53 Degradation. In unstressed cells, TP53 (p53) has a short half-life as it undergoes rapid ubiquitination and proteasome-mediated degradation. The E3 ubiquitin ligase MDM2, which is a transcriptional target of TP53, plays the main role in TP53 protein down-regulation (Wu et al. 1993). MDM2 forms homodimers and homo-oligomers, but also functions as a heterodimer/hetero-oligomer with MDM4 (MDMX) (Sharp et al. 1999, Cheng et al. 2011, Huang et al. 2011, Pant et al. 2011). The heterodimers of MDM2 and MDM4 may be especially important for downregulation of TP53 during embryonic development (Pant et al. 2011).<p>The nuclear localization of MDM2 is positively regulated by AKT- or SGK1- mediated phosphorylation (Mayo and Donner 2001, Zhou et al. 2001, Amato et al. 2009, Lyo et al. 2010). Phosphorylation of MDM2 by CDK1 or CDK2 decreases affinity of MDM2 for TP53 (Zhang and Prives 2001). ATM and CHEK2 kinases, activated by double strand DNA breaks, phosphorylate TP53, reducing its affinity for MDM2 (Banin et al. 1998, Canman et al. 1998, Khanna et al. 1998, Chehab et al. 1999, Chehab et al. 2000). At the same time, ATM phosphorylates MDM2, preventing MDM2 dimerization (Cheng et al. 2009, Cheng et al. 2011). Both ATM and CHEK2 phosphorylate MDM4, triggering MDM2-mediated ubiquitination of MDM4 (Chen et al. 2005, Pereg et al. 2005). Cyclin G1 (CCNG1), transcriptionally induced by TP53, targets the PP2A phosphatase complex to MDM2, resulting in dephosphorylation of MDM2 at specific sites, which can have either a positive or a negative impact on MDM2 function (Okamoto et al. 2002).<p>In contrast to MDM2, E3 ubiquitin ligases RNF34 (CARP1) and RFFL (CARP2) can ubiquitinate phosphorylated TP53 (Yang et al. 2007).<p>In addition to ubiquitinating MDM4 (Pereg et al. 2005), MDM2 can also undergo auto-ubiquitination (Fang et al. 2000). MDM2 and MDM4 can be deubiquitinated by the ubiquitin protease USP2 (Stevenson et al. 2007, Allende-Vega et al. 2010). The ubiquitin protease USP7 can deubiquitinate TP53, but in the presence of DAXX deubiquitinates MDM2 (Li et al. 2002, Sheng et al. 2006, Tang et al. 2006).<p>The tumor suppressor p14-ARF, expressed from the CDKN2A gene in response to oncogenic or oxidative stress, forms a tripartite complex with MDM2 and TP53, sequesters MDM2 from TP53, and thus prevents TP53 degradation (Zhang et al. 1998, Parisi et al. 2002, Voncken et al. 2005).<p>For review of this topic, please refer to Kruse and Gu 2009 R-HSA-6804760 Regulation of TP53 Activity through Methylation. TP53 (p53) undergoes methylation on several lysine and arginine residues, which modulates its transcriptional activity.<p>PRMT5, recruited to TP53 as part of the ATM-activated complex that includes TTC5, JMY and EP300 (p300), methylates TP53 arginine residues R333, R335 and R337. PRMT5-mediated methylation promotes TP53-stimulated expression of cell cycle arrest genes (Shikama et al. 1999, Demonacos et al. 2001, Demonacos et al. 2004, Adams et al. 2008, Adams et al. 2012). SETD9 (SET9) methylates TP53 at lysine residue K372, resulting in increased stability and activity of TP53 (Chuikov et al. 2004, Couture et al. 2006, Bai et al. 2011).<p>TP53 transcriptional activity is repressed by SMYD2-mediated methylation of TP53 at lysine residue K370 (Huang et al. 2006). Dimethylation of TP53 at lysine residue K373 by the complex of methyltransferases EHMT1 and EHMT2 also represses TP53-mediated transcription (Huang et al. 2010). The chromatin compaction factor L3MBTL1 binds TP53 monomethylated at lysine K382 by SETD8 (SET8) and, probably through changing local chromatin architecture, represses transcription of TP53 targets (West et al. 2010). The histone lysine-specific demethylase LSD1 interacts with TP53 and represses p53-mediated transcriptional activation (Huang et al. 2007). PRMT1 and CARM1 can also modulate p53 functions in a cooperative manner (An et al. 2004) R-HSA-69541 Stabilization of p53. Later studies pin-pointed that a single serine (Ser-15) was phosphorylated by ATM and phosphorylation of Ser-15 was rapidly-induced in IR-treated cells and this response was ATM-dependent (Canman et al, 1998; Banin et al, 1998 and Khanna et al, 1998). ATM also regulates the phosphorylation of p53 at other sites, especially Ser-20, by activating other serine/threonine kinases in response to IR (Chehab et al, 2000; Shieh et al, 2000; Hirao et al 2000). Phosphorylation of p53 at Ser-20 interferes with p53-MDM2 interaction. MDM2 is transcriptionally activated by p53 and is a negative regulator of p53 that targets it for degradation (Haupt et al, 1997; Kubbutat et al, 1997). In addition modification of MDM2 by ATM also affects p53 stabilization (Maya et al, 2001) R-HSA-8941858 Regulation of RUNX3 expression and activity. RUNX3, like other RUNX family members, is transcribed from two promoters - the proximal P2 promoter and the distal P1 promoter. The P2 promoter is positioned within a large CpG island that is frequently methylated in solid tumors, resulting in epigenetic inactivation of the RUNX3 gene (reviewed by Levanon and Groner 2004). RUNX3 transcription is affected by SMAD4 levels. RUNX3 may directly upregulate its own transcription through a positive feedback loop (Whittle et al. 2015). Under hypoxic conditions, RUNX3 transcription is downregulated. Hypoxic silencing of RUNX3 involves hypoxia-induced upregulation of the histone methyltransferase G9a and histone deacetylase HDAC1, which leads to increased dimethylation of histone H3 at lysine residue K9 (K10 when taking into account the initiator methionine) and reduced acetylation of histone H3 at the RUNX3 promoter (Lee et al. 2009).RUNX3 protein levels are inversely related to the levels of microRNA miR-130b. Based on in silico analysis, RUNX3 is predicted to be the target of miR-130b, but binding assays and 3'UTR reporter assays have not been done to confirm this (Lai et al. 2010, Paudel et al. 2016).Similar to RUNX1 and RUNX2, RUNX3 forms a transcriptionally active heterodimer with CBFB (CBF-beta) (Kim et al. 2013). RUNX3 activity can be regulated by changes in RUNX3 localization. SRC protein tyrosine kinase phosphorylates RUNX3 on multiple tyrosine residues, inhibiting its translocation from the cytosol to the nucleus and thus inhibiting RUNX3-mediated transcription (Goh et al. 2010). Subcellular localization of RUNX3 may be affected by PIM1-mediated phosphorylation (Kim et al. 2008).The P1 and P2 promoters regulate RUNX3 transcription in a cell-type/differentiation dependent manner, giving rise to the p44 and p46 isoforms of RUNX3, respectively. Several splicing isoforms have also been reported. One example is the generation of a 33 kDa protein isoform (p33) by alternative splicing. The RUNX3 p33 isoform lacks the Runt domain and is unable to transactivate the regulatory regions of integrin genes. The p33 isoform is induced during maturation of monocyte-derived dendritic cells (MDDC), leading to reduced expression of genes involved in inflammatory responses, such as IL8 (interleukin-8) (Puig-Kroger et al. 2010).E3 ubiquitin ligases MDM2 (Chi et al. 2009), SMURF1 and SMURF2 (Jin et al. 2004) are implicated in RUNX3 polyubiquitination and degradation
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABL1 Affinity Capture-Western, Biochemical Activity, Protein-peptide, Reconstituted Complex physical 12110584 , 25624478 , (Europe PMC )NA BioGRID ABL2 Protein-peptide physical 25624478 , (Europe PMC )NA BioGRID ACACA Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID ACTB Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID ADRB2 Biochemical Activity physical 11588219 , (Europe PMC )NA BioGRID AGPS Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID AKT1 Affinity Capture-Western, Biochemical Activity, Co-localization, anti bait coimmunoprecipitation, experimental interaction detection, protein kinase assay, proximity ligation assay association, phosphorylation reaction, physical, physical association 11715018 , 11923280 , 12145204 , 15527798 , 18332867 , 19166854 , 20856200 , 21930127 , 23397142 , 25241761 , (Europe PMC )0.83 BioGRID, IntAct, MINT ALDH16A1 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID ANAPC2 Affinity Capture-Western physical 24804778 , (Europe PMC )NA BioGRID ANG Affinity Capture-Western physical 22266868 , (Europe PMC )NA BioGRID ANKRD17 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct APEX1 Affinity Capture-Western, Biochemical Activity physical 19219073 , (Europe PMC )NA BioGRID APP Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct AR Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 12145204 , 15640443 , 17974989 , 18332867 , 21157430 , 23132866 , 26196320 , 26411689 , 27903893 , 28151478 , 28708672 , (Europe PMC )0.40 BioGRID, IntAct ARHGAP45 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID ARIH2 Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 22819825 , 22940738 , (Europe PMC )0.35 BioGRID, IntAct, MINT ARNTL2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ARRB1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 11588219 , 12538596 , 15878855 , 18544533 , 19879840 , 21081496 , 21466165 , 21857681 , (Europe PMC )0.64 BioGRID, IntAct ARRB2 Affinity Capture-Western, Biochemical Activity, Co-localization, FRET, Two-hybrid, coimmunoprecipitation, experimental interaction detection, pull down, two hybrid, two hybrid array direct interaction, physical, physical association, ubiquitination reaction 11588219 , 12488444 , 12538596 , 15878855 , 17984062 , 18544533 , 21081496 , 21389118 , 21466165 , 21988832 , 26545496 , (Europe PMC )0.71 BioGRID, IntAct, MINT ATF3 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 15933712 , 20592017 , (Europe PMC )NA BioGRID ATF4 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, confocal microscopy, two hybrid colocalization, physical, physical association 21988832 , 27264869 , (Europe PMC )0.44 BioGRID, IntAct ATM Biochemical Activity physical 22976441 , 27462439 , (Europe PMC )NA BioGRID ATP2A2 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID AURKA Affinity Capture-Western, Biochemical Activity physical 24240108 , (Europe PMC )NA BioGRID BAIAP2L1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 21887275 , (Europe PMC )NA BioGRID BANP Affinity Capture-Western, Reconstituted Complex physical 19303885 , 25086032 , (Europe PMC )NA BioGRID BRINP1 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID BTRC Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down physical, physical association 20708156 , (Europe PMC )0.59 BioGRID, IntAct BUB1B Affinity Capture-Western physical 22566641 , (Europe PMC )NA BioGRID CANX Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID CASP2 Biochemical Activity, protease assay physical, protein cleavage 21726810 , (Europe PMC )0.44 BioGRID, IntAct CASP3 Biochemical Activity, Co-localization, protease assay, proximity ligation assay physical, physical association, protein cleavage 21726810 , 24842904 , 25241761 , 9278461 , 9840926 , (Europe PMC )0.44, 0.61 BioGRID, IntAct CCAR1 Affinity Capture-Western physical 18382127 , (Europe PMC )NA BioGRID CCAR2 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID CCND1 Affinity Capture-Western physical 27129163 , (Europe PMC )NA BioGRID CCNG1 Affinity Capture-Western, Reconstituted Complex physical 12556559 , (Europe PMC )NA BioGRID CDH1 Affinity Capture-Western, Reconstituted Complex physical 16980628 , 25086032 , (Europe PMC )NA BioGRID CDK5RAP3 Affinity Capture-Western physical 16173922 , (Europe PMC )NA BioGRID CDK9 Affinity Capture-Western physical 19617712 , (Europe PMC )NA BioGRID CDKN1A Affinity Capture-MS, Affinity Capture-Western, Co-localization, FRET, Reconstituted Complex, proximity ligation assay physical, physical association 14633995 , 14761977 , 17373842 , 20086099 , 20308078 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct CDKN2A Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, Two-hybrid physical 10801444 , 10822382 , 10871849 , 11223036 , 12085228 , 12167711 , 12630860 , 14612427 , 15355988 , 16107876 , 16173922 , 17116689 , 17426254 , 17909018 , 18418067 , 18467333 , 18541670 , 18583933 , 18813780 , 19049976 , 20395212 , 20713054 , 21133853 , 22120712 , 24769896 , 25809483 , 9529248 , 9529249 , 9653180 , 9724636 , (Europe PMC )NA BioGRID CDKN2AIP Affinity Capture-Western physical 17460193 , 18292944 , (Europe PMC )NA BioGRID CENPX Affinity Capture-Western physical 17347673 , (Europe PMC )NA BioGRID CHEK2 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, experimental interaction detection, pull down direct interaction, phosphorylation reaction, physical, physical association 15862297 , 16943424 , 19176998 , (Europe PMC )0.66 BioGRID, IntAct, MINT CLPB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CLSTN1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct CLU Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct CMSS1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID COP1 Affinity Capture-Western physical 20333547 , (Europe PMC )NA BioGRID COPS5 Affinity Capture-Western, Reconstituted Complex physical 17879958 , (Europe PMC )NA BioGRID CREBBP Affinity Capture-RNA, Affinity Capture-Western, Biochemical Activity physical 15013777 , 21149449 , 22349818 , (Europe PMC )NA BioGRID CRTC2 Affinity Capture-Western physical 27362806 , (Europe PMC )NA BioGRID CRTC3 Affinity Capture-Western physical 27362806 , (Europe PMC )NA BioGRID CSNK1A1 Affinity Capture-Western, anti tag coimmunoprecipitation, pull down physical, physical association 19759023 , 20708156 , 22916255 , (Europe PMC )0.52 BioGRID, IntAct CSNK1D Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, pull down colocalization, physical, physical association 16870621 , 20708156 , 22976441 , (Europe PMC )0.61 BioGRID, IntAct CSNK2A1 Biochemical Activity physical 10561590 , 11284721 , (Europe PMC )NA BioGRID CSNK2A2 Biochemical Activity physical 10561590 , (Europe PMC )NA BioGRID CSNK2B Biochemical Activity physical 10561590 , (Europe PMC )NA BioGRID CTBP1 Affinity Capture-Western, Far Western physical 12867035 , (Europe PMC )NA BioGRID CTBP2 Affinity Capture-Western, Reconstituted Complex physical 12867035 , 21057548 , (Europe PMC )NA BioGRID CUL1 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 20708156 , 24804778 , (Europe PMC )0.52 BioGRID, IntAct CUL4A Affinity Capture-Western physical 16861890 , 22032989 , (Europe PMC )NA BioGRID CUL4B Affinity Capture-Western physical 22032989 , (Europe PMC )NA BioGRID CWC25 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct DAPK1 Protein-peptide physical 15001356 , (Europe PMC )NA BioGRID DAPK3 Biochemical Activity, Co-localization, Protein-peptide physical 15001356 , 23146908 , (Europe PMC )NA BioGRID DAXX Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, display technology, fluorescence microscopy, fluorescence technology, nuclear magnetic resonance, pull down association, colocalization, direct interaction, physical, physical association 15364927 , 16845383 , 18566590 , 18583933 , 20195357 , 21134643 , 23038753 , 23405218 , (Europe PMC )0.44, 0.89 BioGRID, IntAct, MINT DCAF8 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID DCD Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17373842 , (Europe PMC )0.35 BioGRID, IntAct DDB1 Affinity Capture-RNA, Affinity Capture-Western physical 22032989 , 24798327 , (Europe PMC )NA BioGRID DDX17 Affinity Capture-Luminescence physical 17226766 , (Europe PMC )NA BioGRID DDX24 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 24980433 , (Europe PMC )NA BioGRID DDX42 Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID DDX5 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID DET1 Affinity Capture-Western physical 17452440 , (Europe PMC )NA BioGRID DHFR Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid physical 18451149 , (Europe PMC )NA BioGRID DHRS2 Affinity Capture-MS, Affinity Capture-Western physical 20547751 , (Europe PMC )NA BioGRID DHX9 Affinity Capture-MS, Affinity Capture-RNA physical 24147044 , 24798327 , (Europe PMC )NA BioGRID DIRAS3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID DLAT Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID DLG4 Affinity Capture-Western, Reconstituted Complex, pull down association, direct interaction, physical 23260144 , (Europe PMC )0.52 BioGRID, IntAct DNAJB1 Affinity Capture-Western, Two-hybrid physical 24361594 , (Europe PMC )NA BioGRID DNAJB4 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct DTL Affinity Capture-Western physical 16861890 , (Europe PMC )NA BioGRID DYRK2 Affinity Capture-Western, Biochemical Activity physical 19965871 , (Europe PMC )NA BioGRID E2F1 Affinity Capture-Western, Biochemical Activity physical 16170383 , 18754770 , (Europe PMC )NA BioGRID EDC4 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID EED Affinity Capture-Western physical 26748827 , (Europe PMC )NA BioGRID EEF1A1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy, pull down association, direct interaction, physical, physical association 17373842 , 23260144 , (Europe PMC )0.71 BioGRID, IntAct EEF2 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID EFTUD2 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID EGR1 Affinity Capture-Western physical 15225550 , (Europe PMC )NA BioGRID EHMT1 Affinity Capture-Western physical 20588255 , (Europe PMC )NA BioGRID EID1 Affinity Capture-Western, Biochemical Activity physical 11073989 , 24167073 , (Europe PMC )NA BioGRID EIF2AK1 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID EIF3B Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID ELF4 Affinity Capture-Western physical 25081543 , (Europe PMC )NA BioGRID EP300 Affinity Capture-Western, Biochemical Activity, Co-fractionation, Reconstituted Complex physical 11070080 , 15013777 , 15154850 , 20234175 , 28196907 , 9809062 , (Europe PMC )NA BioGRID ERBB3 Affinity Capture-Western physical 21930127 , (Europe PMC )NA BioGRID ERBB4 Affinity Capture-Western physical 20858735 , (Europe PMC )NA BioGRID ERCC6 Affinity Capture-Western physical 22032989 , (Europe PMC )NA BioGRID ERCC8 Affinity Capture-Western physical 22032989 , (Europe PMC )NA BioGRID ESR1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid physical, physical association 10766163 , 11178989 , 12897156 , 17545634 , (Europe PMC )0.51 BioGRID, IntAct ESR2 Affinity Capture-Western physical 22349818 , (Europe PMC )NA BioGRID ESYT1 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID EXOSC6 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID EZH2 Affinity Capture-Western physical 26748827 , (Europe PMC )NA BioGRID EZR Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct FBXO31 Affinity Capture-Western, Biochemical Activity physical 26124108 , (Europe PMC )NA BioGRID FBXW11 Affinity Capture-Western, anti tag coimmunoprecipitation, pull down physical, physical association 20708156 , (Europe PMC )0.52 BioGRID, IntAct FHIT Affinity Capture-Western physical 15313915 , (Europe PMC )NA BioGRID FHL2 Affinity Capture-Western, Reconstituted Complex physical 26973248 , (Europe PMC )NA BioGRID FKBP1A Affinity Capture-Western, Reconstituted Complex physical 27617579 , (Europe PMC )NA BioGRID FKBP3 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, two hybrid physical, physical association 19166840 , (Europe PMC )0.51 BioGRID, IntAct, MINT FOXO1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 19321440 , 27412556 , (Europe PMC )NA BioGRID FOXO3 Affinity Capture-RNA, Affinity Capture-Western physical 18204439 , 19321440 , 27886165 , (Europe PMC )NA BioGRID FOXO4 Affinity Capture-Western, Biochemical Activity physical 18665269 , 20874444 , 21525355 , (Europe PMC )NA BioGRID FUBP1 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID G3BP2 Affinity Capture-Western, Reconstituted Complex physical 17297477 , (Europe PMC )NA BioGRID GADD45A Affinity Capture-Western, Biochemical Activity physical 23563151 , (Europe PMC )NA BioGRID GAPDH Affinity Capture-MS physical 17373842 , (Europe PMC )NA BioGRID GATA3 Affinity Capture-Western physical 15975924 , (Europe PMC )NA BioGRID GCAT Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GNAS Affinity Capture-Western physical 18948082 , (Europe PMC )NA BioGRID GNL3 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 18426907 , 19033382 , 21132010 , 24769896 , (Europe PMC )0.40 BioGRID, IntAct GNL3L Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 21132010 , (Europe PMC )0.56 BioGRID, IntAct GORAB Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 20598683 , (Europe PMC )0.52 BioGRID, IntAct, MINT GRK2 Affinity Capture-Luminescence, Affinity Capture-Western physical 17006543 , 21081496 , 26228571 , (Europe PMC )NA BioGRID GSK3B Affinity Capture-Western, Biochemical Activity physical 16055726 , (Europe PMC )NA BioGRID GSN Affinity Capture-MS physical 17373842 , (Europe PMC )NA BioGRID GTF2E2 Reconstituted Complex physical 9271120 , (Europe PMC )NA BioGRID GTF2I Affinity Capture-MS, Affinity Capture-RNA, Affinity Capture-Western physical 24147044 , 24798327 , 26656605 , (Europe PMC )NA BioGRID HCK Protein-peptide physical 25624478 , (Europe PMC )NA BioGRID HDAC1 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 12426395 , 15640443 , (Europe PMC )NA BioGRID HEXIM1 Affinity Capture-Western physical 19617712 , (Europe PMC )NA BioGRID HEY1 Reconstituted Complex physical 27129302 , (Europe PMC )NA BioGRID HIF1A Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid physical 10640274 , 12606552 , 19696166 , 25447306 , 25535359 , (Europe PMC )NA BioGRID HIPK2 Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, experimental interaction detection, pull down phosphorylation reaction, physical, physical association 16212962 , 17349959 , 23826318 , (Europe PMC )0.62 BioGRID, IntAct, MINT HIST1H2BJ Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HIST2H2BE Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 15546622 , (Europe PMC )NA BioGRID HIST3H3 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 20588255 , (Europe PMC )NA BioGRID HLA-DMB Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct HMGN1 Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID HNF4A Affinity Capture-Western physical 22197810 , (Europe PMC )NA BioGRID HNRNPD Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID HNRNPK Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 19249676 , 22825850 , 23092970 , (Europe PMC )0.59 BioGRID, IntAct, MINT HNRNPM Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID HNRNPU Affinity Capture-MS, Affinity Capture-RNA physical 24147044 , 24798327 , (Europe PMC )NA BioGRID HRNR Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID HSP90AA1 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Protein-peptide, Reconstituted Complex physical 15001356 , 15001357 , 20540933 , 24147044 , (Europe PMC )NA BioGRID HSP90AB1 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID HSP90B1 Affinity Capture-Western, Reconstituted Complex, display technology physical, physical association 20195357 , 25637791 , (Europe PMC )0.40 BioGRID, IntAct HSPA4 Affinity Capture-Western physical 20540933 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS, Affinity Capture-Western, display technology physical, physical association 20195357 , 20540933 , 24147044 , (Europe PMC )0.40 BioGRID, IntAct IARS Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID IER2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID IER3 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 26973248 , (Europe PMC )NA BioGRID IFI16 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID IGF1R Affinity Capture-Western, Biochemical Activity, Co-localization, display technology, proximity ligation assay physical, physical association 12821780 , 18632619 , 19165858 , 20195357 , 25241761 , 28092675 , (Europe PMC )0.59 BioGRID, IntAct IGF2BP3 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID ILF3 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID IPO7 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID IRF1 Affinity Capture-Western, Biochemical Activity, Protein-peptide, Reconstituted Complex physical 23134341 , 24583282 , 24721577 , 27795392 , (Europe PMC )NA BioGRID IRF2 Affinity Capture-Western, Biochemical Activity, Protein-peptide physical 19032150 , 24583282 , (Europe PMC )NA BioGRID ITCH Affinity Capture-Western physical 21093410 , 26025930 , (Europe PMC )NA BioGRID IYD Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID JAK1 Affinity Capture-Western physical 24413661 , 27362806 , (Europe PMC )NA BioGRID JUN Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct JUND Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct KARS Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID KAT2B Affinity Capture-Western, Biochemical Activity, Phenotypic Suppression, Reconstituted Complex genetic, physical 12068014 , 14769800 , 21060154 , 28286521 , (Europe PMC )NA BioGRID KAT5 Affinity Capture-Western, Reconstituted Complex physical 11927554 , 18264029 , 18499675 , 19150978 , (Europe PMC )NA BioGRID KIAA1551 Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID KPNA1 Reconstituted Complex physical 28196907 , (Europe PMC )NA BioGRID KPNA6 Affinity Capture-Western, Reconstituted Complex physical 28196907 , (Europe PMC )NA BioGRID KRT14 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17373842 , (Europe PMC )0.35 BioGRID, IntAct KRT2 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID LAMP2 Affinity Capture-Western physical 20540933 , (Europe PMC )NA BioGRID LATS1 Affinity Capture-Western physical 22195963 , (Europe PMC )NA BioGRID LATS2 Affinity Capture-Western, Two-hybrid physical 17015431 , (Europe PMC )NA BioGRID LMO7 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MAGEA2 Affinity Capture-Western, Protein-peptide, Reconstituted Complex physical 26001071 , (Europe PMC )NA BioGRID MAK16 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAP1LC3A Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID MAP2 Biochemical Activity, display technology physical, physical association 20195357 , 24124579 , (Europe PMC )0.40 BioGRID, IntAct MAPKAPK2 Biochemical Activity physical 15688025 , (Europe PMC )NA BioGRID MDC1 Affinity Capture-Western, Protein-peptide physical 14578343 , 18471438 , (Europe PMC )NA BioGRID MDM2 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-fractionation, Co-localization, PCA, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid array physical, physical association 10722742 , 11724934 , 14517261 , 14596917 , 15001357 , 15280377 , 15950904 , 16331255 , 16338389 , 16714300 , 16803902 , 16845383 , 16905769 , 16965791 , 17159902 , 17170710 , 17301054 , 17347673 , 17373842 , 17426254 , 17936559 , 17989425 , 19132120 , 19166840 , 19619542 , 19683495 , 20479273 , 20484049 , 20705607 , 21060154 , 21084285 , 22333590 , 22493164 , 22989009 , 23671280 , 23871895 , 24147044 , 24755078 , 24804778 , 25659040 , 25809483 , 25888903 , 26720344 , 27215386 , 28166445 , 28196907 , (Europe PMC )0.74 BioGRID, IntAct, MINT MDM4 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-localization, Co-purification, FRET, PCA, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, imaging technique, pull down, two hybrid, two hybrid array association, colocalization, physical, physical association 10218570 , 10608892 , 10827196 , 11606419 , 12370303 , 12393902 , 12483531 , 12860999 , 12874296 , 15604276 , 16055726 , 16227609 , 17159902 , 17301054 , 17616658 , 18219319 , 18566590 , 19432880 , 19619542 , 19683495 , 19838211 , 20473904 , 20484049 , 20705607 , 20724842 , 21925390 , 21988832 , 22120712 , 22266850 , 22333590 , 22493164 , 22902369 , 23028042 , 23671280 , 23946421 , 24755078 , 24813712 , 25105592 , 25384516 , 25512388 , 25659040 , 25703327 , 25809483 , 25825738 , 26001071 , 26359458 , 26720344 , 27215386 , 27617579 , 27621617 , 28514442 , (Europe PMC )0.93 BioGRID, IntAct, MINT MED1 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down physical, physical association 15848166 , (Europe PMC )0.52 BioGRID, IntAct, MINT MKRN3 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct MRE11 Affinity Capture-MS, Affinity Capture-Western physical 15734743 , (Europe PMC )NA BioGRID MS4A1 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID MSI2 Affinity Capture-Western physical 28223335 , (Europe PMC )NA BioGRID MTA1 Affinity Capture-Western physical 19837670 , (Europe PMC )NA BioGRID MTBP Affinity Capture-Western, Phenotypic Suppression, Reconstituted Complex, Two-hybrid genetic, physical 10906133 , 15632057 , (Europe PMC )NA BioGRID MYD88 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MYDGF Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID NACA Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct NAT10 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 26882543 , (Europe PMC )NA BioGRID NBN Affinity Capture-MS, Affinity Capture-Western physical 15734743 , 18541670 , (Europe PMC )NA BioGRID NCL Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, display technology, far western blotting, pull down direct interaction, physical, physical association 16751805 , 20195357 , 22103682 , 24147044 , (Europe PMC )0.71 BioGRID, IntAct, MINT NEDD4 Affinity Capture-Western, Biochemical Activity, Protein-peptide physical 15001356 , 24413081 , (Europe PMC )NA BioGRID NEK9 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID NGFR Affinity Capture-Western, Reconstituted Complex physical 27282385 , (Europe PMC )NA BioGRID NLK Affinity Capture-Western physical 24926618 , (Europe PMC )NA BioGRID NME2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 21504894 , (Europe PMC )NA BioGRID NOC2L Affinity Capture-Western, Co-localization, Reconstituted Complex physical 24413661 , (Europe PMC )NA BioGRID NOLC1 Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID NOP53 Two-hybrid physical 21988832 , (Europe PMC )NA BioGRID NOTCH1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 22128911 , 23252402 , (Europe PMC )NA BioGRID NOTCH4 Affinity Capture-Western physical 21402876 , (Europe PMC )NA BioGRID NPIPB3 Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID NPM1 Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, direct interaction, physical, physical association 15144954 , 22510990 , 23039052 , (Europe PMC )0.35, 0.70 BioGRID, IntAct, MINT NR0B2 Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 22197810 , 22575647 , (Europe PMC )0.52 BioGRID, IntAct, MINT NR3C1 Affinity Capture-Western physical 11562347 , (Europe PMC )NA BioGRID NUCKS1 Biochemical Activity, display technology physical, physical association 20195357 , 24124579 , (Europe PMC )0.40 BioGRID, IntAct NUMB Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid physical 12646252 , 16678796 , 18172499 , 22337874 , 23252402 , 27106262 , 28223335 , (Europe PMC )NA BioGRID OGDH Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID OGDHL Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID PA2G4 Affinity Capture-Western physical 21098709 , 21930127 , (Europe PMC )NA BioGRID PAK1IP1 Affinity Capture-Western physical 21097889 , (Europe PMC )NA BioGRID PAK6 Affinity Capture-Western, Biochemical Activity physical 23132866 , (Europe PMC )NA BioGRID PBX1 Biochemical Activity, Reconstituted Complex physical 23044487 , (Europe PMC )NA BioGRID PBXIP1 Affinity Capture-Western, Biochemical Activity physical 24488098 , (Europe PMC )NA BioGRID PCNA Affinity Capture-Western physical 16861890 , 20733054 , (Europe PMC )NA BioGRID PDCD5 Affinity Capture-Western physical 22914926 , (Europe PMC )NA BioGRID PDE4D Affinity Capture-Western, Biochemical Activity physical 19372219 , (Europe PMC )NA BioGRID PDGFB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PDIA3 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID PDLIM7 Affinity Capture-Western, Reconstituted Complex physical 21060154 , (Europe PMC )NA BioGRID PDS5A Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID PER2 Affinity Capture-Western physical 25103245 , (Europe PMC )NA BioGRID PGAM1 Affinity Capture-Western physical 24567357 , (Europe PMC )NA BioGRID PGAM2 Affinity Capture-Western, Biochemical Activity physical 24567357 , (Europe PMC )NA BioGRID PHF7 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct PHLDB3 Affinity Capture-Western, Reconstituted Complex physical 28008906 , (Europe PMC )NA BioGRID PIAS1 Biochemical Activity physical 12393906 , (Europe PMC )NA BioGRID PIM1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, protein kinase assay phosphorylation reaction, physical 18467333 , 19166854 , (Europe PMC )0.44 BioGRID, IntAct, MINT PKM Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, display technology physical, physical association 20195357 , 27264869 , (Europe PMC )0.40 BioGRID, IntAct PLK1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, protein kinase assay, pull down phosphorylation reaction, physical, physical association 19833129 , (Europe PMC )0.60 BioGRID, IntAct, MINT PML Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, imaging technique association, colocalization, direct interaction, physical, physical association 12759344 , 12915590 , 14507915 , 15195100 , 19150978 , 20972456 , 22869143 , 23169665 , (Europe PMC )0.58, 0.61 BioGRID, IntAct POLH Affinity Capture-Western physical 22056306 , (Europe PMC )NA BioGRID POT1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PPAN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PPARD Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PPARG Affinity Capture-Western physical 26718225 , (Europe PMC )NA BioGRID PPIB Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID PPM1D Affinity Capture-Western, anti bait coimmunoprecipitation, phosphatase assay dephosphorylation reaction, physical, physical association 17936559 , (Europe PMC )0.54 BioGRID, IntAct PPP1CA Affinity Capture-Western physical 26636645 , (Europe PMC )NA BioGRID PRDM2 Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID PSMA3 Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 20308078 , 22659184 , (Europe PMC )0.40 BioGRID, IntAct, MINT PSMA7 Affinity Capture-Western, Co-fractionation physical 16337594 , 20479273 , (Europe PMC )NA BioGRID PSMA8 Affinity Capture-Western physical 22659184 , (Europe PMC )NA BioGRID PSMB6 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 22659184 , (Europe PMC )0.40 BioGRID, IntAct, MINT PSMC1 Affinity Capture-Western physical 20479273 , (Europe PMC )NA BioGRID PSMC3 Affinity Capture-Western, Co-fractionation, Reconstituted Complex physical 20479273 , 22659184 , (Europe PMC )NA BioGRID PSMC5 Affinity Capture-Western, Co-fractionation, Reconstituted Complex physical 20479273 , (Europe PMC )NA BioGRID PSMC6 Affinity Capture-Western physical 20479273 , (Europe PMC )NA BioGRID PSMD1 Co-fractionation physical 20479273 , (Europe PMC )NA BioGRID PSMD10 Affinity Capture-Western, Reconstituted Complex physical 16023600 , 17904523 , 18332869 , (Europe PMC )NA BioGRID PSMD2 Affinity Capture-Western, Co-fractionation physical 18086887 , 20479273 , (Europe PMC )NA BioGRID PSMD4 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 19240029 , 20479273 , 22350919 , 22659184 , (Europe PMC )NA BioGRID PSME3 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, molecular sieving, pull down association, physical, physical association 18309296 , 21084564 , (Europe PMC )0.61 BioGRID, IntAct, MINT PTBP1 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID PTK2 Reconstituted Complex physical 18206965 , (Europe PMC )NA BioGRID PTPA Affinity Capture-Western physical 22525275 , (Europe PMC )NA BioGRID PYHIN1 Affinity Capture-MS, Affinity Capture-Western physical 16479015 , 26186194 , (Europe PMC )NA BioGRID RAB8A Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID RABL6 Affinity Capture-Western, Reconstituted Complex physical 23572512 , (Europe PMC )NA BioGRID RAD23A Affinity Capture-Western, Reconstituted Complex physical 15064742 , (Europe PMC )NA BioGRID RAD50 Affinity Capture-MS, Affinity Capture-Western physical 15734743 , (Europe PMC )NA BioGRID RAD54B Affinity Capture-Western physical 25384516 , (Europe PMC )NA BioGRID RANBP1 Biochemical Activity physical 12393906 , (Europe PMC )NA BioGRID RANBP2 Biochemical Activity physical 12393906 , (Europe PMC )NA BioGRID RARA Affinity Capture-Western, Biochemical Activity physical 26776160 , (Europe PMC )NA BioGRID RARS Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID RASSF1 Affinity Capture-Western physical 18566590 , 23038753 , (Europe PMC )NA BioGRID RASSF3 Affinity Capture-Western physical 22593196 , (Europe PMC )NA BioGRID RASSF5 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation physical, physical association 22173032 , (Europe PMC )0.40 BioGRID, IntAct, MINT RASSF6 Affinity Capture-Western physical 24003224 , (Europe PMC )NA BioGRID RB1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, physical, physical association 10078201 , 11433299 , 15044952 , 15485814 , 16337594 , 16374512 , 16510145 , 20871633 , 21990374 , 25703327 , 7791904 , 9003773 , (Europe PMC )0.73 BioGRID, IntAct, MINT RBBP6 Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation physical, physical association 17470788 , 24124579 , (Europe PMC )0.40 BioGRID, IntAct RBBP8 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID RBM38 Affinity Capture-RNA, Protein-RNA physical 22710720 , (Europe PMC )NA BioGRID RCHY1 Affinity Capture-Western, Reconstituted Complex physical 19483087 , 20333547 , (Europe PMC )NA BioGRID RECQL Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID RELA Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid array physical, physical association 21988832 , 23839035 , (Europe PMC )0.37 BioGRID, IntAct RFFL Affinity Capture-Western physical 18382127 , (Europe PMC )NA BioGRID RFPL2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID RFWD3 Affinity Capture-Western, Reconstituted Complex physical 20173098 , (Europe PMC )NA BioGRID RHOA Affinity Capture-Western physical 22907703 , (Europe PMC )NA BioGRID RIDA Two-hybrid physical 21988832 , (Europe PMC )NA BioGRID RLIM Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 26926424 , (Europe PMC )NA BioGRID RN5S1@ Affinity Capture-RNA physical 21925390 , (Europe PMC )NA BioGRID RNF10 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct RNF126 Two-hybrid physical 22493164 , (Europe PMC )NA BioGRID RNF2 Affinity Capture-Western physical 23318437 , (Europe PMC )NA BioGRID RNF8 Two-hybrid physical 22493164 , (Europe PMC )NA BioGRID RPL10A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID RPL11 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid, two hybrid array association, physical, physical association 12842086 , 14612427 , 15308643 , 15314173 , 15314174 , 16803902 , 17110929 , 17116689 , 17242401 , 17310983 , 17373842 , 18426907 , 18560357 , 19713960 , 20547751 , 20554519 , 21097889 , 21399665 , 21804542 , 21903592 , 21988832 , 23169665 , 23507139 , 23728348 , 23776465 , 26908445 , 27856536 , (Europe PMC )0.91 BioGRID, IntAct, MINT RPL15 Affinity Capture-MS, Biochemical Activity physical 24124579 , 28514442 , (Europe PMC )NA BioGRID RPL22L1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID RPL23 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, two hybrid physical, physical association 15308643 , 15314173 , 17110929 , 17116689 , 17310983 , 20547751 , 23169665 , (Europe PMC )0.57 BioGRID, IntAct, MINT RPL23A Affinity Capture-Western physical 26203195 , (Europe PMC )NA BioGRID RPL26 Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 18951086 , 20542919 , 21988832 , 23169665 , (Europe PMC )0.37 BioGRID, IntAct RPL36A Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID RPL37 Affinity Capture-Western physical 23874713 , (Europe PMC )NA BioGRID RPL37A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RPL4 Affinity Capture-Western, Reconstituted Complex physical 26908445 , (Europe PMC )NA BioGRID RPL5 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation association, physical, physical association 14612427 , 15308643 , 15314173 , 15314174 , 17110929 , 17116689 , 17242401 , 17373842 , 18426907 , 18560357 , 20547751 , 20554519 , 21097889 , 21399665 , 21925390 , 23169665 , 26908445 , 7935455 , (Europe PMC )0.67 BioGRID, IntAct, MINT RPL6 Affinity Capture-Western physical 24174547 , (Europe PMC )NA BioGRID RPS11 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RPS14 Affinity Capture-Western physical 22391559 , 22525275 , 23246961 , 27336364 , (Europe PMC )NA BioGRID RPS15 Affinity Capture-Western physical 23874713 , (Europe PMC )NA BioGRID RPS20 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, pull down association, physical 17373842 , 19656744 , 23874713 , (Europe PMC )0.53 BioGRID, IntAct RPS23 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID RPS25 Affinity Capture-Western physical 22777350 , (Europe PMC )NA BioGRID RPS26 Affinity Capture-Western physical 23728348 , (Europe PMC )NA BioGRID RPS27 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down direct interaction, physical, physical association 21170087 , (Europe PMC )0.60 BioGRID, IntAct RPS27A Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 21561866 , 21988832 , (Europe PMC )0.37 BioGRID, IntAct RPS27L Affinity Capture-Western, Reconstituted Complex physical 21170087 , (Europe PMC )NA BioGRID RPS3 Affinity Capture-Western, FRET, Reconstituted Complex, anti bait coimmunoprecipitation, fluorescent resonance energy transfer, proximity ligation assay, pull down, ubiquitinase assay association, direct interaction, physical, physical association, ubiquitination reaction 19656744 , (Europe PMC )0.70 BioGRID, IntAct RPS6 Affinity Capture-Western physical 23169665 , (Europe PMC )NA BioGRID RPS6KB1 Affinity Capture-Western physical 20657550 , (Europe PMC )NA BioGRID RPS7 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid association, direct interaction, physical, physical association 17310983 , 19683495 , 21561866 , 21988832 , 23169665 , 23563151 , 28514442 , (Europe PMC )0.75 BioGRID, IntAct RRM1 Affinity Capture-Western physical 26228206 , (Europe PMC )NA BioGRID RRM2B Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 19015526 , (Europe PMC )0.40 BioGRID, IntAct RRP1 Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID RSL1D1 Affinity Capture-Western, Reconstituted Complex physical 27811966 , (Europe PMC )NA BioGRID RUNX3 Affinity Capture-Western physical 19808967 , (Europe PMC )NA BioGRID RUVBL2 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID RYBP Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid association, physical, physical association 19098711 , (Europe PMC )0.62 BioGRID, IntAct, MINT RYR2 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct S100A1 Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT S100A2 Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT S100A4 Reconstituted Complex, competition binding, molecular sieving, surface plasmon resonance direct interaction, physical, physical association 20591429 , (Europe PMC )0.61 BioGRID, IntAct, MINT S100A6 Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT S100B Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT SDHC Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SENP3 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 21316347 , (Europe PMC )NA BioGRID SESN2 Two-hybrid physical 21988832 , (Europe PMC )NA BioGRID SET Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct SETD7 Reconstituted Complex physical 26317544 , (Europe PMC )NA BioGRID SETDB1 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SF3B1 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID SF3B3 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID SFN Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation association, physical 17546054 , 19166854 , (Europe PMC )0.35 BioGRID, IntAct, MINT SFPQ Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID SHARPIN Affinity Capture-Western physical 28063307 , (Europe PMC )NA BioGRID SHPK Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SIRT1 Affinity Capture-Western, Biochemical Activity physical 28196907 , (Europe PMC )NA BioGRID SIRT2 Biochemical Activity physical 28196907 , (Europe PMC )NA BioGRID SIRT3 Biochemical Activity physical 28196907 , (Europe PMC )NA BioGRID SIRT6 Affinity Capture-MS, Affinity Capture-Western physical 25074979 , 28196907 , 28514442 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-Western physical 28196907 , (Europe PMC )NA BioGRID SIVA1 Affinity Capture-Western physical 19590512 , 22343716 , (Europe PMC )NA BioGRID SMARCA2 Reconstituted Complex physical 25384516 , (Europe PMC )NA BioGRID SMARCA4 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID SMARCE1 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID SMG7 Affinity Capture-Western, Reconstituted Complex physical 27462439 , (Europe PMC )NA BioGRID SMURF1 Affinity Capture-Western, Reconstituted Complex physical 20484049 , (Europe PMC )NA BioGRID SNAI1 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 20385133 , 22128911 , (Europe PMC )0.40 BioGRID, IntAct, MINT SNAI2 Affinity Capture-RNA, Affinity Capture-Western physical 23438693 , 26992741 , (Europe PMC )NA BioGRID SND1 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID SORBS2 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SOX4 Affinity Capture-Western physical 19234109 , (Europe PMC )NA BioGRID SP1 Affinity Capture-Western physical 22378045 , (Europe PMC )NA BioGRID SRC Affinity Capture-Western, Biochemical Activity, Protein-peptide, Reconstituted Complex physical 25624478 , (Europe PMC )NA BioGRID SREK1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct SRSF11 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID SUMO1 Biochemical Activity physical 12297306 , (Europe PMC )NA BioGRID SURF2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SUV39H1 Affinity Capture-Western physical 20588255 , 26971997 , (Europe PMC )NA BioGRID SUZ12 Affinity Capture-Western physical 26748827 , (Europe PMC )NA BioGRID TAB1 Affinity Capture-Western physical 23934659 , (Europe PMC )NA BioGRID TAF1 Affinity Capture-Western, Reconstituted Complex physical 17237821 , 9388200 , (Europe PMC )NA BioGRID TBP Reconstituted Complex, pull down physical, physical association 9271120 , 9388200 , (Europe PMC )0.40 BioGRID, IntAct TBRG1 Affinity Capture-Western physical 17110379 , (Europe PMC )NA BioGRID TCAP Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, two hybrid fragment pooling approach physical, physical association 16678796 , 23414517 , (Europe PMC )0.37 BioGRID, IntAct TERT Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 20453884 , 26370108 , (Europe PMC )NA BioGRID TFIP11 Affinity Capture-Western, Reconstituted Complex physical 26460617 , (Europe PMC )NA BioGRID TFRC Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID TOP1 Affinity Capture-MS, Protein-peptide physical 24147044 , 24583282 , (Europe PMC )NA BioGRID TP53 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-RNA, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-fractionation, Co-localization, FRET, Far Western, PCA, Phenotypic Suppression, Protein-RNA, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, chromatin immunoprecipitation assay, classical fluorescence spectroscopy, cosedimentation in solution, enzyme linked immunosorbent assay, fluorescence polarization spectroscopy, isothermal titration calorimetry, molecular sieving, nuclear magnetic resonance, peptide array, proximity ligation assay, pull down, surface plasmon resonance, two hybrid, ubiquitinase assay, x-ray crystallography association, direct interaction, genetic, physical, physical association, ubiquitination reaction 10196247 , 10202144 , 10347217 , 10435614 , 10488081 , 10561590 , 10562557 , 10640350 , 10681559 , 10722742 , 10766163 , 10827196 , 10889512 , 10980696 , 11046142 , 11070080 , 11094089 , 11112690 , 11178989 , 11284721 , 11285227 , 11351297 , 11384992 , 11431470 , 11486026 , 11562347 , 11572869 , 11597128 , 11697899 , 11709713 , 11713287 , 11713288 , 11714701 , 11744695 , 11839577 , 11925449 , 12167711 , 12208736 , 12381304 , 12426395 , 12552135 , 12612087 , 12620407 , 12690203 , 12842086 , 12897156 , 12915590 , 12944468 , 14499615 , 14517261 , 14559824 , 14596917 , 14612427 , 14671306 , 14702041 , 14704432 , 14741215 , 15001357 , 15013777 , 15053879 , 15058298 , 15064742 , 15094782 , 15122315 , 15144954 , 15154850 , 15210108 , 15242646 , 15247280 , 15280377 , 15295102 , 15308643 , 15313915 , 15358376 , 15542844 , 15550400 , 15558054 , 15604276 , 15824742 , 15848166 , 15908921 , 15933712 , 15950904 , 16023600 , 16055726 , 16107876 , 1614537 , 16152627 , 16159876 , 16173922 , 16201274 , 16212962 , 16215989 , 16331255 , 16338390 , 16414131 , 16432196 , 16547496 , 16579792 , 16595680 , 16624812 , 16678796 , 16751805 , 16845383 , 16857591 , 16861890 , 16866370 , 16870621 , 16905769 , 16964247 , 17056014 , 17080083 , 17098746 , 17116689 , 17139261 , 17159902 , 17268548 , 17290220 , 17297477 , 17301054 , 17302414 , 17310983 , 17318220 , 17347673 , 17363365 , 17369817 , 17380154 , 17426254 , 17438265 , 17470788 , 17525743 , 17591690 , 17616658 , 17666403 , 17848574 , 17875722 , 17908790 , 17936559 , 17989425 , 18061646 , 18172499 , 18223694 , 18234963 , 18309296 , 18316739 , 18332869 , 18467333 , 18485870 , 18541670 , 18566590 , 18604177 , 18665269 , 18813780 , 18815136 , 18981217 , 19033382 , 19071110 , 19081178 , 19085961 , 19098711 , 19106616 , 19153082 , 19160491 , 19166840 , 19188367 , 19223463 , 19234109 , 19255450 , 19303885 , 19305137 , 19332559 , 19357310 , 19411066 , 19411846 , 19483087 , 19568783 , 19590512 , 19597489 , 19656744 , 19805293 , 19816404 , 19837670 , 19857530 , 19941302 , 20047188 , 20080206 , 20124408 , 20173098 , 20174603 , 20234175 , 20235143 , 20395212 , 20479273 , 20484049 , 20542919 , 20570896 , 20588255 , 20591429 , 20591651 , 20639885 , 20657550 , 20659896 , 20660730 , 20694676 , 20705607 , 20708156 , 20837658 , 20847049 , 20959462 , 20962272 , 21060154 , 21071676 , 21075307 , 21084285 , 21084564 , 21088494 , 21098709 , 21132010 , 21149449 , 21170087 , 21261729 , 21268072 , 21316347 , 21317885 , 21454483 , 21465263 , 21471462 , 21478269 , 21561866 , 21572037 , 21584881 , 21726810 , 21750659 , 21857681 , 21887275 , 21925390 , 21965653 , 21986495 , 21988832 , 22032989 , 22083959 , 22084066 , 22085928 , 22103682 , 22124327 , 22157679 , 22227409 , 22262183 , 22266850 , 22266868 , 22301280 , 22318540 , 22331460 , 22366412 , 22374672 , 22389628 , 22391559 , 22411991 , 22444248 , 22474335 , 22487680 , 22510990 , 22525275 , 22575647 , 22588298 , 22653443 , 22659184 , 22737255 , 22807444 , 22819825 , 22912717 , 22914926 , 22916255 , 22920093 , 22948151 , 22975381 , 23134341 , 23150668 , 23169665 , 23201157 , 23246961 , 23252402 , 23261415 , 23318437 , 23370271 , 23402884 , 23443559 , 23483203 , 23572512 , 23609977 , 23671280 , 23728348 , 23776060 , 23776465 , 23802716 , 23826318 , 23880345 , 23946421 , 24127580 , 24200963 , 24207125 , 24240685 , 24314634 , 24361594 , 24413661 , 24462112 , 24488098 , 24567357 , 24621507 , 24643130 , 24659749 , 24667498 , 24842904 , 24926618 , 24980433 , 24998844 , 25103245 , 25156994 , 25168242 , 25241761 , 25277184 , 25283148 , 25312347 , 25313037 , 25362358 , 25384516 , 25417702 , 25464845 , 25512388 , 25543083 , 25609649 , 25624478 , 25637791 , 25739118 , 25954860 , 26001071 , 26186194 , 26203195 , 26238070 , 26350565 , 26475964 , 26540344 , 26556313 , 26578655 , 26673821 , 26720344 , 26876197 , 26882543 , 26883110 , 26908445 , 27031960 , 27106262 , 27129163 , 27215386 , 27282385 , 27308622 , 27336364 , 27462439 , 27543608 , 27807478 , 27811966 , 27856536 , 27886165 , 27893708 , 28082682 , 28223335 , 28362432 , 28394340 , 28514442 , 28542145 , 28549433 , 28553961 , 28605833 , 7686617 , 7689721 , 8058315 , 8875929 , 9131587 , 9223638 , 9271120 , 9278461 , 9363941 , 9450543 , 9529249 , 9582019 , 9724739 , 9809062 , 9824166 , (Europe PMC )0.99 BioGRID, IntAct, MINT TP53I3 Affinity Capture-Western, Reconstituted Complex physical 28605833 , (Europe PMC )NA BioGRID TP53RK Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID TP63 Affinity Capture-Western, Reconstituted Complex physical 11714701 , 20571051 , 21088494 , 25417702 , (Europe PMC )NA BioGRID TP73 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, classical fluorescence spectroscopy, nuclear magnetic resonance direct interaction, physical 10207051 , 10435614 , 10469568 , 18499675 , 19218448 , 20588255 , 21088494 , 21261729 , 25301064 , 25417702 , 26025930 , (Europe PMC )0.56 BioGRID, IntAct TPR Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID TPT1 Affinity Capture-Western, Reconstituted Complex physical 22912717 , (Europe PMC )NA BioGRID TRAF5 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TRIM13 Affinity Capture-Western, Biochemical Activity physical 21333377 , (Europe PMC )NA BioGRID TRIM23 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRIM27 Affinity Capture-Western, Biochemical Activity physical 20972456 , (Europe PMC )NA BioGRID TRIM28 Affinity Capture-MS, Affinity Capture-Western physical 16107876 , 17056014 , 20858735 , (Europe PMC )NA BioGRID TRIM4 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TRIM9 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TSC22D3 Affinity Capture-Western, Co-localization physical 25168242 , (Europe PMC )NA BioGRID TSG101 Affinity Capture-Western physical 11172000 , 17060450 , (Europe PMC )NA BioGRID TSPYL6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TTF1 Affinity Capture-Western, Reconstituted Complex physical 22383580 , (Europe PMC )NA BioGRID TUBA1C Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17373842 , (Europe PMC )0.35 BioGRID, IntAct TUBB Affinity Capture-MS, display technology physical, physical association 17373842 , 20195357 , (Europe PMC )0.40 BioGRID, IntAct TUBB2A Affinity Capture-MS physical 17373842 , (Europe PMC )NA BioGRID U2AF2 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID UBC Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, physical, physical association 16023600 , 17170710 , 17290220 , 18566590 , 19098711 , 19166840 , 24143256 , (Europe PMC )0.82 BioGRID, IntAct, MINT UBE2A Affinity Capture-Western physical 12640129 , 22083959 , (Europe PMC )NA BioGRID UBE2B Affinity Capture-Western physical 22083959 , (Europe PMC )NA BioGRID UBE2D1 Reconstituted Complex, Two-hybrid physical 12646252 , 12690203 , 14671306 , 15001357 , 15013777 , 15242646 , 15280377 , 17170710 , 17301054 , 17848574 , 18632619 , 19032150 , 19240029 , 19247369 , 19597489 , 19805293 , 19965871 , 20124408 , 20173098 , 20694676 , 21157430 , 21887275 , 22124327 , 22331460 , 22916255 , 23150668 , 23671280 , 24980433 , 25543083 , 25624478 , 25888903 , 27106262 , 27903893 , 28362432 , 9450543 , (Europe PMC )NA BioGRID UBE2D2 Biochemical Activity, Reconstituted Complex, molecular sieving direct interaction, physical 10562557 , 10722742 , 11713287 , 11724934 , 14517261 , 14769800 , 15280377 , 15950904 , 16338390 , 17159902 , 17349959 , 18451149 , 18632619 , 18665269 , 19219073 , 19372219 , 19619542 , 19816404 , 20705607 , 20874444 , 21084285 , 21965653 , 22157679 , 22301280 , 22902369 , 22989009 , 23871895 , 24127580 , 24567357 , 24980433 , 26025930 , 28553961 , (Europe PMC )0.44 BioGRID, IntAct UBE2D3 Reconstituted Complex physical 11486026 , 15280377 , 15546622 , 19656744 , 19683495 , 20453884 , 20484049 , 21060154 , 21572037 , 21965653 , 22032989 , 24167073 , 24842904 , 24980433 , 28605833 , (Europe PMC )NA BioGRID UBE2E2 Reconstituted Complex physical 21965653 , 24980433 , (Europe PMC )NA BioGRID UBE2E3 Reconstituted Complex physical 21965653 , 24980433 , (Europe PMC )NA BioGRID UBE2G2 Two-hybrid, two hybrid array physical, physical association 19690564 , (Europe PMC )0.37 BioGRID, IntAct UBE2I Affinity Capture-Western, Biochemical Activity, Protein-peptide, Reconstituted Complex physical 11384992 , (Europe PMC )NA BioGRID UBE2K Reconstituted Complex, Two-hybrid physical 15280377 , 21965653 , 23933584 , (Europe PMC )NA BioGRID UBE2L3 Reconstituted Complex physical 16714300 , 24980433 , (Europe PMC )NA BioGRID UBE2M Affinity Capture-Western, Reconstituted Complex physical 15242646 , 25624478 , (Europe PMC )NA BioGRID UBE2N Reconstituted Complex physical 21965653 , (Europe PMC )NA BioGRID UBE2U Two-hybrid, two hybrid array physical, physical association 19690564 , (Europe PMC )0.37 BioGRID, IntAct UBE2Z Two-hybrid, two hybrid array physical, physical association 19690564 , (Europe PMC )0.37 BioGRID, IntAct UBE3A Biochemical Activity physical 11486026 , (Europe PMC )NA BioGRID UBE4B Affinity Capture-Western, Co-fractionation, Reconstituted Complex physical 21317885 , 24587254 , (Europe PMC )NA BioGRID UBTF Biochemical Activity, Protein-peptide physical 24124579 , 24583282 , (Europe PMC )NA BioGRID UCHL1 Affinity Capture-Western physical 20395212 , (Europe PMC )NA BioGRID UIMC1 Affinity Capture-Western physical 19433585 , (Europe PMC )NA BioGRID USO1 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID USP10 Affinity Capture-Western physical 20096447 , (Europe PMC )NA BioGRID USP15 Reconstituted Complex physical 27893708 , (Europe PMC )NA BioGRID USP2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down physical, physical association 17290220 , (Europe PMC )0.40 BioGRID, IntAct, MINT USP26 Affinity Capture-Western physical 27810359 , (Europe PMC )NA BioGRID USP42 Affinity Capture-Western physical 22085928 , (Europe PMC )NA BioGRID USP48 Affinity Capture-Western physical 28233861 , (Europe PMC )NA BioGRID USP7 Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, classical fluorescence spectroscopy, isothermal titration calorimetry, molecular sieving, pull down, x-ray crystallography association, direct interaction, physical, physical association 15916963 , 16402859 , 16474402 , 16845383 , 16943424 , 17380154 , 17936559 , 18566590 , 20713061 , 20816748 , 22056774 , 24462112 , 26238070 , 26460617 , 26971997 , 27452404 , 28196907 , (Europe PMC )0.96 BioGRID, IntAct, MINT VCP Affinity Capture-MS physical 23383273 , 24147044 , (Europe PMC )NA BioGRID VDR Affinity Capture-Western physical 25969952 , (Europe PMC )NA BioGRID VEGFA Affinity Capture-RNA, Protein-RNA physical 28274247 , (Europe PMC )NA BioGRID WT1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct WWOX Affinity Capture-Western physical 16219768 , 25447306 , (Europe PMC )NA BioGRID XAGE1A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID XIAP Affinity Capture-Western, Protein-peptide, Reconstituted Complex physical 19411066 , 23749209 , 25888903 , (Europe PMC )NA BioGRID XPC Affinity Capture-Western, Reconstituted Complex physical 24258024 , (Europe PMC )NA BioGRID XPO1 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID XRCC6 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 19247369 , 24147044 , (Europe PMC )NA BioGRID YAF2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID YWHAQ Affinity Capture-Western, Reconstituted Complex physical 16943424 , 20086099 , (Europe PMC )NA BioGRID YY1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 15210108 , 22659184 , (Europe PMC )0.40 BioGRID, IntAct, MINT YY1AP1 Two-hybrid physical 21988832 , (Europe PMC )NA BioGRID ZNF133 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct ZNF274 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF318 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID ZNF420 Affinity Capture-Western, Reconstituted Complex physical 25691462 , (Europe PMC )NA BioGRID ZNF550 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF668 Affinity Capture-Western physical 21852383 , (Europe PMC )NA BioGRID ZNF764 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ANKRD17 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct APP Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct AR Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 12145204 , 15640443 , 17974989 , 18332867 , 21157430 , 23132866 , 26196320 , 26411689 , 27903893 , 28151478 , 28708672 , (Europe PMC )0.40 BioGRID, IntAct ARHGEF6 display technology physical association 20195357 , (Europe PMC )0.40 IntAct ARIH2 Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 22819825 , 22940738 , (Europe PMC )0.35 BioGRID, IntAct, MINT ARRB1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 11588219 , 12538596 , 15878855 , 18544533 , 19879840 , 21081496 , 21466165 , 21857681 , (Europe PMC )0.64 BioGRID, IntAct ARRB2 Affinity Capture-Western, Biochemical Activity, Co-localization, FRET, Two-hybrid, coimmunoprecipitation, experimental interaction detection, pull down, two hybrid, two hybrid array direct interaction, physical, physical association, ubiquitination reaction 11588219 , 12488444 , 12538596 , 15878855 , 17984062 , 18544533 , 21081496 , 21389118 , 21466165 , 21988832 , 26545496 , (Europe PMC )0.71 BioGRID, IntAct, MINT ATF4 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, confocal microscopy, two hybrid colocalization, physical, physical association 21988832 , 27264869 , (Europe PMC )0.44 BioGRID, IntAct BAIAP2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct BC032729 anti bait coimmunoprecipitation, nucleic acid uv cross-linking assay physical association 19411066 , (Europe PMC )0.40 IntAct BHLHE40 anti tag coimmunoprecipitation physical association 17347673 , (Europe PMC )0.40 IntAct, MINT BTRC Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down physical, physical association 20708156 , (Europe PMC )0.59 BioGRID, IntAct CASP2 Biochemical Activity, protease assay physical, protein cleavage 21726810 , (Europe PMC )0.44 BioGRID, IntAct CASP3 Biochemical Activity, Co-localization, protease assay, proximity ligation assay physical, physical association, protein cleavage 21726810 , 24842904 , 25241761 , 9278461 , 9840926 , (Europe PMC )0.44, 0.61 BioGRID, IntAct CDKN1A Affinity Capture-MS, Affinity Capture-Western, Co-localization, FRET, Reconstituted Complex, proximity ligation assay physical, physical association 14633995 , 14761977 , 17373842 , 20086099 , 20308078 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct CDKN2A anti bait coimmunoprecipitation, coimmunoprecipitation, fluorescence microscopy association, colocalization, physical association 12740913 , 17909018 , 18583933 , 19166854 , 20713054 , (Europe PMC )0.81 IntAct, MINT CDKN2B anti bait coimmunoprecipitation association 17373842 , (Europe PMC )0.35 IntAct CHEK2 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, experimental interaction detection, pull down direct interaction, phosphorylation reaction, physical, physical association 15862297 , 16943424 , 19176998 , (Europe PMC )0.66 BioGRID, IntAct, MINT CHRM3 display technology physical association 20195357 , (Europe PMC )0.40 IntAct CLSTN1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct CLU Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct CSNK1A1 Affinity Capture-Western, anti tag coimmunoprecipitation, pull down physical, physical association 19759023 , 20708156 , 22916255 , (Europe PMC )0.52 BioGRID, IntAct CSNK1D Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, pull down colocalization, physical, physical association 16870621 , 20708156 , 22976441 , (Europe PMC )0.61 BioGRID, IntAct CSNK1E anti tag coimmunoprecipitation, pull down physical association 20708156 , (Europe PMC )0.52 IntAct CUL1 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 20708156 , 24804778 , (Europe PMC )0.52 BioGRID, IntAct CWC25 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct DAAM2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct DAXX Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, display technology, fluorescence microscopy, fluorescence technology, nuclear magnetic resonance, pull down association, colocalization, direct interaction, physical, physical association 15364927 , 16845383 , 18566590 , 18583933 , 20195357 , 21134643 , 23038753 , 23405218 , (Europe PMC )0.44, 0.89 BioGRID, IntAct, MINT DCD Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17373842 , (Europe PMC )0.35 BioGRID, IntAct DLG4 Affinity Capture-Western, Reconstituted Complex, pull down association, direct interaction, physical 23260144 , (Europe PMC )0.52 BioGRID, IntAct DNAJB4 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct EBI-1800051 electrophoretic mobility shift assay, electrophoretic mobility supershift assay association 18485870 , (Europe PMC )0.46 IntAct EBI-4399559 anti bait coimmunoprecipitation, comigration in sds page direct interaction, physical association 19805293 , 22056774 , (Europe PMC )0.61 IntAct EEF1A1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy, pull down association, direct interaction, physical, physical association 17373842 , 23260144 , (Europe PMC )0.71 BioGRID, IntAct EEF1G display technology physical association 20195357 , (Europe PMC )0.40 IntAct EPS15 display technology physical association 20195357 , (Europe PMC )0.40 IntAct ERICH3 display technology physical association 20195357 , (Europe PMC )0.40 IntAct ESR1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid physical, physical association 10766163 , 11178989 , 12897156 , 17545634 , (Europe PMC )0.51 BioGRID, IntAct EZR Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct FAM171A1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct FBXW11 Affinity Capture-Western, anti tag coimmunoprecipitation, pull down physical, physical association 20708156 , (Europe PMC )0.52 BioGRID, IntAct FBXW7 pull down physical association 20708156 , (Europe PMC )0.40 IntAct FEZ1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct FKBP3 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, two hybrid physical, physical association 19166840 , (Europe PMC )0.51 BioGRID, IntAct, MINT GABRA2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct GAPDHS anti bait coimmunoprecipitation association 17373842 , (Europe PMC )0.35 IntAct GCAT Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GNL2 anti tag coimmunoprecipitation physical association 21132010 , (Europe PMC )0.40 IntAct GNL3 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 18426907 , 19033382 , 21132010 , 24769896 , (Europe PMC )0.40 BioGRID, IntAct GNL3L Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 21132010 , (Europe PMC )0.56 BioGRID, IntAct GORAB Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 20598683 , (Europe PMC )0.52 BioGRID, IntAct, MINT GRK2 anti bait coimmunoprecipitation physical association 17006543 , (Europe PMC )0.40 IntAct, MINT GSTP1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct HIPK1 fluorescence microscopy colocalization 22173032 , (Europe PMC )0.27 IntAct, MINT HIPK2 Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, experimental interaction detection, pull down phosphorylation reaction, physical, physical association 16212962 , 17349959 , 23826318 , (Europe PMC )0.62 BioGRID, IntAct, MINT HLA-DMB Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct HNRNPK Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 19249676 , 22825850 , 23092970 , (Europe PMC )0.59 BioGRID, IntAct, MINT HSP90B1 Affinity Capture-Western, Reconstituted Complex, display technology physical, physical association 20195357 , 25637791 , (Europe PMC )0.40 BioGRID, IntAct HSPA8 Affinity Capture-MS, Affinity Capture-Western, display technology physical, physical association 20195357 , 20540933 , 24147044 , (Europe PMC )0.40 BioGRID, IntAct IGF1R Affinity Capture-Western, Biochemical Activity, Co-localization, display technology, proximity ligation assay physical, physical association 12821780 , 18632619 , 19165858 , 20195357 , 25241761 , 28092675 , (Europe PMC )0.59 BioGRID, IntAct JMY anti bait coimmunoprecipitation physical association 17170761 , (Europe PMC )0.40 IntAct, MINT JUN Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct JUND Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct KIF5A display technology physical association 20195357 , (Europe PMC )0.40 IntAct KRT14 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17373842 , (Europe PMC )0.35 BioGRID, IntAct LMO7 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MAP2 Biochemical Activity, display technology physical, physical association 20195357 , 24124579 , (Europe PMC )0.40 BioGRID, IntAct MAP4K4 display technology physical association 20195357 , (Europe PMC )0.40 IntAct MARS display technology physical association 20195357 , (Europe PMC )0.40 IntAct MDM2 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-fractionation, Co-localization, PCA, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid array physical, physical association 10722742 , 11724934 , 14517261 , 14596917 , 15001357 , 15280377 , 15950904 , 16331255 , 16338389 , 16714300 , 16803902 , 16845383 , 16905769 , 16965791 , 17159902 , 17170710 , 17301054 , 17347673 , 17373842 , 17426254 , 17936559 , 17989425 , 19132120 , 19166840 , 19619542 , 19683495 , 20479273 , 20484049 , 20705607 , 21060154 , 21084285 , 22333590 , 22493164 , 22989009 , 23671280 , 23871895 , 24147044 , 24755078 , 24804778 , 25659040 , 25809483 , 25888903 , 26720344 , 27215386 , 28166445 , 28196907 , (Europe PMC )0.74 BioGRID, IntAct, MINT MDM4 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-localization, Co-purification, FRET, PCA, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, imaging technique, pull down, two hybrid, two hybrid array association, colocalization, physical, physical association 10218570 , 10608892 , 10827196 , 11606419 , 12370303 , 12393902 , 12483531 , 12860999 , 12874296 , 15604276 , 16055726 , 16227609 , 17159902 , 17301054 , 17616658 , 18219319 , 18566590 , 19432880 , 19619542 , 19683495 , 19838211 , 20473904 , 20484049 , 20705607 , 20724842 , 21925390 , 21988832 , 22120712 , 22266850 , 22333590 , 22493164 , 22902369 , 23028042 , 23671280 , 23946421 , 24755078 , 24813712 , 25105592 , 25384516 , 25512388 , 25659040 , 25703327 , 25809483 , 25825738 , 26001071 , 26359458 , 26720344 , 27215386 , 27617579 , 27621617 , 28514442 , (Europe PMC )0.93 BioGRID, IntAct, MINT MEA1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct MED1 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down physical, physical association 15848166 , (Europe PMC )0.52 BioGRID, IntAct, MINT MGEA5 display technology physical association 20195357 , (Europe PMC )0.40 IntAct MKRN3 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct MRPS33 display technology physical association 20195357 , (Europe PMC )0.40 IntAct MYD88 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct NACA Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct NAP1L1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct NCL Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, display technology, far western blotting, pull down direct interaction, physical, physical association 16751805 , 20195357 , 22103682 , 24147044 , (Europe PMC )0.71 BioGRID, IntAct, MINT NDUFA12 display technology physical association 20195357 , (Europe PMC )0.40 IntAct NEFM display technology physical association 20195357 , (Europe PMC )0.40 IntAct NOP53 two hybrid physical association 21988832 , (Europe PMC )0.37 IntAct NPM1 Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, direct interaction, physical, physical association 15144954 , 22510990 , 23039052 , (Europe PMC )0.35, 0.70 BioGRID, IntAct, MINT NR0B2 Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 22197810 , 22575647 , (Europe PMC )0.52 BioGRID, IntAct, MINT NSD2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct NUCKS1 Biochemical Activity, display technology physical, physical association 20195357 , 24124579 , (Europe PMC )0.40 BioGRID, IntAct NUDT9 display technology physical association 20195357 , (Europe PMC )0.40 IntAct NUMB anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, direct interaction, physical association 18172499 , (Europe PMC )0.40, 0.62 IntAct OTUB1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, direct interaction, physical association 22124327 , (Europe PMC )0.63 IntAct, MINT PFDN6 display technology physical association 20195357 , (Europe PMC )0.40 IntAct PHF7 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct PIM1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, protein kinase assay phosphorylation reaction, physical 18467333 , 19166854 , (Europe PMC )0.44 BioGRID, IntAct, MINT PIM2 protein kinase assay phosphorylation reaction 19166854 , (Europe PMC )0.44 IntAct, MINT PIM3 protein kinase assay phosphorylation reaction 19166854 , (Europe PMC )0.44 IntAct, MINT PKM Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, display technology physical, physical association 20195357 , 27264869 , (Europe PMC )0.40 BioGRID, IntAct PLK1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, protein kinase assay, pull down phosphorylation reaction, physical, physical association 19833129 , (Europe PMC )0.60 BioGRID, IntAct, MINT PML Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, imaging technique association, colocalization, direct interaction, physical, physical association 12759344 , 12915590 , 14507915 , 15195100 , 19150978 , 20972456 , 22869143 , 23169665 , (Europe PMC )0.58, 0.61 BioGRID, IntAct POT1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PPM1D Affinity Capture-Western, anti bait coimmunoprecipitation, phosphatase assay dephosphorylation reaction, physical, physical association 17936559 , (Europe PMC )0.54 BioGRID, IntAct PPP2R5C anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical association 21460856 , (Europe PMC )0.50, 0.56 IntAct PRPF6 display technology physical association 20195357 , (Europe PMC )0.40 IntAct PRRC2C display technology physical association 20195357 , (Europe PMC )0.40 IntAct PSMA3 Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 20308078 , 22659184 , (Europe PMC )0.40 BioGRID, IntAct, MINT PSMA6 anti bait coimmunoprecipitation physical association 22659184 , (Europe PMC )0.40 IntAct, MINT PSMB6 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 22659184 , (Europe PMC )0.40 BioGRID, IntAct, MINT PSME3 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, molecular sieving, pull down association, physical, physical association 18309296 , 21084564 , (Europe PMC )0.61 BioGRID, IntAct, MINT PTPRD display technology physical association 20195357 , (Europe PMC )0.40 IntAct RASGRF1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct RASSF1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical association 18566590 , (Europe PMC )0.50 IntAct, MINT RASSF5 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation physical, physical association 22173032 , (Europe PMC )0.40 BioGRID, IntAct, MINT RB1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, physical, physical association 10078201 , 11433299 , 15044952 , 15485814 , 16337594 , 16374512 , 16510145 , 20871633 , 21990374 , 25703327 , 7791904 , 9003773 , (Europe PMC )0.73 BioGRID, IntAct, MINT RBBP6 Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation physical, physical association 17470788 , 24124579 , (Europe PMC )0.40 BioGRID, IntAct RCN2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct RELA Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid array physical, physical association 21988832 , 23839035 , (Europe PMC )0.37 BioGRID, IntAct RFWD3 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, direct interaction, physical association 20173098 , (Europe PMC )0.50, 0.59 IntAct RIDA two hybrid physical association 21988832 , (Europe PMC )0.37 IntAct RNF10 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct RNF126 two hybrid array physical association 22493164 , (Europe PMC )0.37 IntAct RNF8 two hybrid array physical association 22493164 , (Europe PMC )0.37 IntAct RPL11 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid, two hybrid array association, physical, physical association 12842086 , 14612427 , 15308643 , 15314173 , 15314174 , 16803902 , 17110929 , 17116689 , 17242401 , 17310983 , 17373842 , 18426907 , 18560357 , 19713960 , 20547751 , 20554519 , 21097889 , 21399665 , 21804542 , 21903592 , 21988832 , 23169665 , 23507139 , 23728348 , 23776465 , 26908445 , 27856536 , (Europe PMC )0.91 BioGRID, IntAct, MINT RPL23 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, two hybrid physical, physical association 15308643 , 15314173 , 17110929 , 17116689 , 17310983 , 20547751 , 23169665 , (Europe PMC )0.57 BioGRID, IntAct, MINT RPL26 Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 18951086 , 20542919 , 21988832 , 23169665 , (Europe PMC )0.37 BioGRID, IntAct RPL27A display technology physical association 20195357 , (Europe PMC )0.40 IntAct RPL5 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation association, physical, physical association 14612427 , 15308643 , 15314173 , 15314174 , 17110929 , 17116689 , 17242401 , 17373842 , 18426907 , 18560357 , 20547751 , 20554519 , 21097889 , 21399665 , 21925390 , 23169665 , 26908445 , 7935455 , (Europe PMC )0.67 BioGRID, IntAct, MINT RPS20 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, pull down association, physical 17373842 , 19656744 , 23874713 , (Europe PMC )0.53 BioGRID, IntAct RPS27 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down direct interaction, physical, physical association 21170087 , (Europe PMC )0.60 BioGRID, IntAct RPS27A Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 21561866 , 21988832 , (Europe PMC )0.37 BioGRID, IntAct RPS27L anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, pull down colocalization, direct interaction, physical association 21170087 , (Europe PMC )0.62 IntAct RPS3 Affinity Capture-Western, FRET, Reconstituted Complex, anti bait coimmunoprecipitation, fluorescent resonance energy transfer, proximity ligation assay, pull down, ubiquitinase assay association, direct interaction, physical, physical association, ubiquitination reaction 19656744 , (Europe PMC )0.70 BioGRID, IntAct RPS7 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid association, direct interaction, physical, physical association 17310983 , 19683495 , 21561866 , 21988832 , 23169665 , 23563151 , 28514442 , (Europe PMC )0.75 BioGRID, IntAct RRM2B Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 19015526 , (Europe PMC )0.40 BioGRID, IntAct RYBP Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid association, physical, physical association 19098711 , (Europe PMC )0.62 BioGRID, IntAct, MINT RYR2 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct S100A1 Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT S100A2 Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT S100A4 Reconstituted Complex, competition binding, molecular sieving, surface plasmon resonance direct interaction, physical, physical association 20591429 , (Europe PMC )0.61 BioGRID, IntAct, MINT S100A6 Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT S100B Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT SDHC Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SEC63 display technology physical association 20195357 , (Europe PMC )0.40 IntAct SESN2 two hybrid physical association 21988832 , (Europe PMC )0.37 IntAct SET Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct SETDB1 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SFN Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation association, physical 17546054 , 19166854 , (Europe PMC )0.35 BioGRID, IntAct, MINT SHPK Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SMC3 display technology physical association 20195357 , (Europe PMC )0.40 IntAct SNAI1 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 20385133 , 22128911 , (Europe PMC )0.40 BioGRID, IntAct, MINT SORBS2 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SREK1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct SRP19 display technology physical association 20195357 , (Europe PMC )0.40 IntAct STX1A display technology physical association 20195357 , (Europe PMC )0.40 IntAct TBCA display technology physical association 20195357 , (Europe PMC )0.40 IntAct TBP Reconstituted Complex, pull down physical, physical association 9271120 , 9388200 , (Europe PMC )0.40 BioGRID, IntAct TCAP Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, two hybrid fragment pooling approach physical, physical association 16678796 , 23414517 , (Europe PMC )0.37 BioGRID, IntAct TMEM87A display technology physical association 20195357 , (Europe PMC )0.40 IntAct TP53 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-RNA, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-fractionation, Co-localization, FRET, Far Western, PCA, Phenotypic Suppression, Protein-RNA, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, chromatin immunoprecipitation assay, classical fluorescence spectroscopy, cosedimentation in solution, enzyme linked immunosorbent assay, fluorescence polarization spectroscopy, isothermal titration calorimetry, molecular sieving, nuclear magnetic resonance, peptide array, proximity ligation assay, pull down, surface plasmon resonance, two hybrid, ubiquitinase assay, x-ray crystallography association, direct interaction, genetic, physical, physical association, ubiquitination reaction 10196247 , 10202144 , 10347217 , 10435614 , 10488081 , 10561590 , 10562557 , 10640350 , 10681559 , 10722742 , 10766163 , 10827196 , 10889512 , 10980696 , 11046142 , 11070080 , 11094089 , 11112690 , 11178989 , 11284721 , 11285227 , 11351297 , 11384992 , 11431470 , 11486026 , 11562347 , 11572869 , 11597128 , 11697899 , 11709713 , 11713287 , 11713288 , 11714701 , 11744695 , 11839577 , 11925449 , 12167711 , 12208736 , 12381304 , 12426395 , 12552135 , 12612087 , 12620407 , 12690203 , 12842086 , 12897156 , 12915590 , 12944468 , 14499615 , 14517261 , 14559824 , 14596917 , 14612427 , 14671306 , 14702041 , 14704432 , 14741215 , 15001357 , 15013777 , 15053879 , 15058298 , 15064742 , 15094782 , 15122315 , 15144954 , 15154850 , 15210108 , 15242646 , 15247280 , 15280377 , 15295102 , 15308643 , 15313915 , 15358376 , 15542844 , 15550400 , 15558054 , 15604276 , 15824742 , 15848166 , 15908921 , 15933712 , 15950904 , 16023600 , 16055726 , 16107876 , 1614537 , 16152627 , 16159876 , 16173922 , 16201274 , 16212962 , 16215989 , 16331255 , 16338390 , 16414131 , 16432196 , 16547496 , 16579792 , 16595680 , 16624812 , 16678796 , 16751805 , 16845383 , 16857591 , 16861890 , 16866370 , 16870621 , 16905769 , 16964247 , 17056014 , 17080083 , 17098746 , 17116689 , 17139261 , 17159902 , 17268548 , 17290220 , 17297477 , 17301054 , 17302414 , 17310983 , 17318220 , 17347673 , 17363365 , 17369817 , 17380154 , 17426254 , 17438265 , 17470788 , 17525743 , 17591690 , 17616658 , 17666403 , 17848574 , 17875722 , 17908790 , 17936559 , 17989425 , 18061646 , 18172499 , 18223694 , 18234963 , 18309296 , 18316739 , 18332869 , 18467333 , 18485870 , 18541670 , 18566590 , 18604177 , 18665269 , 18813780 , 18815136 , 18981217 , 19033382 , 19071110 , 19081178 , 19085961 , 19098711 , 19106616 , 19153082 , 19160491 , 19166840 , 19188367 , 19223463 , 19234109 , 19255450 , 19303885 , 19305137 , 19332559 , 19357310 , 19411066 , 19411846 , 19483087 , 19568783 , 19590512 , 19597489 , 19656744 , 19805293 , 19816404 , 19837670 , 19857530 , 19941302 , 20047188 , 20080206 , 20124408 , 20173098 , 20174603 , 20234175 , 20235143 , 20395212 , 20479273 , 20484049 , 20542919 , 20570896 , 20588255 , 20591429 , 20591651 , 20639885 , 20657550 , 20659896 , 20660730 , 20694676 , 20705607 , 20708156 , 20837658 , 20847049 , 20959462 , 20962272 , 21060154 , 21071676 , 21075307 , 21084285 , 21084564 , 21088494 , 21098709 , 21132010 , 21149449 , 21170087 , 21261729 , 21268072 , 21316347 , 21317885 , 21454483 , 21465263 , 21471462 , 21478269 , 21561866 , 21572037 , 21584881 , 21726810 , 21750659 , 21857681 , 21887275 , 21925390 , 21965653 , 21986495 , 21988832 , 22032989 , 22083959 , 22084066 , 22085928 , 22103682 , 22124327 , 22157679 , 22227409 , 22262183 , 22266850 , 22266868 , 22301280 , 22318540 , 22331460 , 22366412 , 22374672 , 22389628 , 22391559 , 22411991 , 22444248 , 22474335 , 22487680 , 22510990 , 22525275 , 22575647 , 22588298 , 22653443 , 22659184 , 22737255 , 22807444 , 22819825 , 22912717 , 22914926 , 22916255 , 22920093 , 22948151 , 22975381 , 23134341 , 23150668 , 23169665 , 23201157 , 23246961 , 23252402 , 23261415 , 23318437 , 23370271 , 23402884 , 23443559 , 23483203 , 23572512 , 23609977 , 23671280 , 23728348 , 23776060 , 23776465 , 23802716 , 23826318 , 23880345 , 23946421 , 24127580 , 24200963 , 24207125 , 24240685 , 24314634 , 24361594 , 24413661 , 24462112 , 24488098 , 24567357 , 24621507 , 24643130 , 24659749 , 24667498 , 24842904 , 24926618 , 24980433 , 24998844 , 25103245 , 25156994 , 25168242 , 25241761 , 25277184 , 25283148 , 25312347 , 25313037 , 25362358 , 25384516 , 25417702 , 25464845 , 25512388 , 25543083 , 25609649 , 25624478 , 25637791 , 25739118 , 25954860 , 26001071 , 26186194 , 26203195 , 26238070 , 26350565 , 26475964 , 26540344 , 26556313 , 26578655 , 26673821 , 26720344 , 26876197 , 26882543 , 26883110 , 26908445 , 27031960 , 27106262 , 27129163 , 27215386 , 27282385 , 27308622 , 27336364 , 27462439 , 27543608 , 27807478 , 27811966 , 27856536 , 27886165 , 27893708 , 28082682 , 28223335 , 28362432 , 28394340 , 28514442 , 28542145 , 28549433 , 28553961 , 28605833 , 7686617 , 7689721 , 8058315 , 8875929 , 9131587 , 9223638 , 9271120 , 9278461 , 9363941 , 9450543 , 9529249 , 9582019 , 9724739 , 9809062 , 9824166 , (Europe PMC )0.99 BioGRID, IntAct, MINT TP73 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, classical fluorescence spectroscopy, nuclear magnetic resonance direct interaction, physical 10207051 , 10435614 , 10469568 , 18499675 , 19218448 , 20588255 , 21088494 , 21261729 , 25301064 , 25417702 , 26025930 , (Europe PMC )0.56 BioGRID, IntAct TRAF5 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TRIM23 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TRIM4 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TRIM9 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TSNAX display technology physical association 20195357 , (Europe PMC )0.40 IntAct TUBA1C Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17373842 , (Europe PMC )0.35 BioGRID, IntAct TUBB Affinity Capture-MS, display technology physical, physical association 17373842 , 20195357 , (Europe PMC )0.40 BioGRID, IntAct TUBB1 anti bait coimmunoprecipitation association 17373842 , (Europe PMC )0.35 IntAct UBB anti tag coimmunoprecipitation physical association 17936559 , (Europe PMC )0.40 IntAct UBC Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, physical, physical association 16023600 , 17170710 , 17290220 , 18566590 , 19098711 , 19166840 , 24143256 , (Europe PMC )0.82 BioGRID, IntAct, MINT UBE2D2 Biochemical Activity, Reconstituted Complex, molecular sieving direct interaction, physical 10562557 , 10722742 , 11713287 , 11724934 , 14517261 , 14769800 , 15280377 , 15950904 , 16338390 , 17159902 , 17349959 , 18451149 , 18632619 , 18665269 , 19219073 , 19372219 , 19619542 , 19816404 , 20705607 , 20874444 , 21084285 , 21965653 , 22157679 , 22301280 , 22902369 , 22989009 , 23871895 , 24127580 , 24567357 , 24980433 , 26025930 , 28553961 , (Europe PMC )0.44 BioGRID, IntAct UBE2G2 Two-hybrid, two hybrid array physical, physical association 19690564 , (Europe PMC )0.37 BioGRID, IntAct UBE2U Two-hybrid, two hybrid array physical, physical association 19690564 , (Europe PMC )0.37 BioGRID, IntAct UBE2Z Two-hybrid, two hybrid array physical, physical association 19690564 , (Europe PMC )0.37 BioGRID, IntAct USP2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down physical, physical association 17290220 , (Europe PMC )0.40 BioGRID, IntAct, MINT USP7 Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, classical fluorescence spectroscopy, isothermal titration calorimetry, molecular sieving, pull down, x-ray crystallography association, direct interaction, physical, physical association 15916963 , 16402859 , 16474402 , 16845383 , 16943424 , 17380154 , 17936559 , 18566590 , 20713061 , 20816748 , 22056774 , 24462112 , 26238070 , 26460617 , 26971997 , 27452404 , 28196907 , (Europe PMC )0.96 BioGRID, IntAct, MINT WDR45 display technology physical association 20195357 , (Europe PMC )0.40 IntAct WT1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct YY1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 15210108 , 22659184 , (Europe PMC )0.40 BioGRID, IntAct, MINT YY1AP1 two hybrid physical association 21988832 , (Europe PMC )0.37 IntAct ZBTB1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct ZNF133 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct ZNF326 display technology physical association 20195357 , (Europe PMC )0.40 IntAct ZNF766 display technology physical association 20195357 , (Europe PMC )0.40 IntAct ZNHIT6 display technology physical association 20195357 , (Europe PMC )0.40 IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ARIH2 Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 22819825 , 22940738 , (Europe PMC )0.35 BioGRID, IntAct, MINT ARRB2 Affinity Capture-Western, Biochemical Activity, Co-localization, FRET, Two-hybrid, coimmunoprecipitation, experimental interaction detection, pull down, two hybrid, two hybrid array direct interaction, physical, physical association, ubiquitination reaction 11588219 , 12488444 , 12538596 , 15878855 , 17984062 , 18544533 , 21081496 , 21389118 , 21466165 , 21988832 , 26545496 , (Europe PMC )0.71 BioGRID, IntAct, MINT BHLHE40 anti tag coimmunoprecipitation physical association 17347673 , (Europe PMC )0.40 IntAct, MINT CDKN2A anti bait coimmunoprecipitation, coimmunoprecipitation, fluorescence microscopy association, colocalization, physical association 12740913 , 17909018 , 18583933 , 19166854 , 20713054 , (Europe PMC )0.81 IntAct, MINT CHEK2 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, experimental interaction detection, pull down direct interaction, phosphorylation reaction, physical, physical association 15862297 , 16943424 , 19176998 , (Europe PMC )0.66 BioGRID, IntAct, MINT DAXX Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, display technology, fluorescence microscopy, fluorescence technology, nuclear magnetic resonance, pull down association, colocalization, direct interaction, physical, physical association 15364927 , 16845383 , 18566590 , 18583933 , 20195357 , 21134643 , 23038753 , 23405218 , (Europe PMC )0.44, 0.89 BioGRID, IntAct, MINT FKBP3 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, two hybrid physical, physical association 19166840 , (Europe PMC )0.51 BioGRID, IntAct, MINT GORAB Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 20598683 , (Europe PMC )0.52 BioGRID, IntAct, MINT GRK2 anti bait coimmunoprecipitation physical association 17006543 , (Europe PMC )0.40 IntAct, MINT HIPK1 fluorescence microscopy colocalization 22173032 , (Europe PMC )0.27 IntAct, MINT HIPK2 Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, experimental interaction detection, pull down phosphorylation reaction, physical, physical association 16212962 , 17349959 , 23826318 , (Europe PMC )0.62 BioGRID, IntAct, MINT HNRNPK Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 19249676 , 22825850 , 23092970 , (Europe PMC )0.59 BioGRID, IntAct, MINT JMY anti bait coimmunoprecipitation physical association 17170761 , (Europe PMC )0.40 IntAct, MINT MDM2 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-fractionation, Co-localization, PCA, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid array physical, physical association 10722742 , 11724934 , 14517261 , 14596917 , 15001357 , 15280377 , 15950904 , 16331255 , 16338389 , 16714300 , 16803902 , 16845383 , 16905769 , 16965791 , 17159902 , 17170710 , 17301054 , 17347673 , 17373842 , 17426254 , 17936559 , 17989425 , 19132120 , 19166840 , 19619542 , 19683495 , 20479273 , 20484049 , 20705607 , 21060154 , 21084285 , 22333590 , 22493164 , 22989009 , 23671280 , 23871895 , 24147044 , 24755078 , 24804778 , 25659040 , 25809483 , 25888903 , 26720344 , 27215386 , 28166445 , 28196907 , (Europe PMC )0.74 BioGRID, IntAct, MINT MDM4 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-localization, Co-purification, FRET, PCA, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, imaging technique, pull down, two hybrid, two hybrid array association, colocalization, physical, physical association 10218570 , 10608892 , 10827196 , 11606419 , 12370303 , 12393902 , 12483531 , 12860999 , 12874296 , 15604276 , 16055726 , 16227609 , 17159902 , 17301054 , 17616658 , 18219319 , 18566590 , 19432880 , 19619542 , 19683495 , 19838211 , 20473904 , 20484049 , 20705607 , 20724842 , 21925390 , 21988832 , 22120712 , 22266850 , 22333590 , 22493164 , 22902369 , 23028042 , 23671280 , 23946421 , 24755078 , 24813712 , 25105592 , 25384516 , 25512388 , 25659040 , 25703327 , 25809483 , 25825738 , 26001071 , 26359458 , 26720344 , 27215386 , 27617579 , 27621617 , 28514442 , (Europe PMC )0.93 BioGRID, IntAct, MINT MED1 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down physical, physical association 15848166 , (Europe PMC )0.52 BioGRID, IntAct, MINT NCL Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, display technology, far western blotting, pull down direct interaction, physical, physical association 16751805 , 20195357 , 22103682 , 24147044 , (Europe PMC )0.71 BioGRID, IntAct, MINT NPM1 Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, direct interaction, physical, physical association 15144954 , 22510990 , 23039052 , (Europe PMC )0.35, 0.70 BioGRID, IntAct, MINT NR0B2 Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 22197810 , 22575647 , (Europe PMC )0.52 BioGRID, IntAct, MINT OTUB1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, direct interaction, physical association 22124327 , (Europe PMC )0.63 IntAct, MINT PIM1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, protein kinase assay phosphorylation reaction, physical 18467333 , 19166854 , (Europe PMC )0.44 BioGRID, IntAct, MINT PIM2 protein kinase assay phosphorylation reaction 19166854 , (Europe PMC )0.44 IntAct, MINT PIM3 protein kinase assay phosphorylation reaction 19166854 , (Europe PMC )0.44 IntAct, MINT PLK1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, protein kinase assay, pull down phosphorylation reaction, physical, physical association 19833129 , (Europe PMC )0.60 BioGRID, IntAct, MINT PSMA3 Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 20308078 , 22659184 , (Europe PMC )0.40 BioGRID, IntAct, MINT PSMA6 anti bait coimmunoprecipitation physical association 22659184 , (Europe PMC )0.40 IntAct, MINT PSMB6 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 22659184 , (Europe PMC )0.40 BioGRID, IntAct, MINT PSME3 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, molecular sieving, pull down association, physical, physical association 18309296 , 21084564 , (Europe PMC )0.61 BioGRID, IntAct, MINT RASSF1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical association 18566590 , (Europe PMC )0.50 IntAct, MINT RASSF5 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation physical, physical association 22173032 , (Europe PMC )0.40 BioGRID, IntAct, MINT RB1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, physical, physical association 10078201 , 11433299 , 15044952 , 15485814 , 16337594 , 16374512 , 16510145 , 20871633 , 21990374 , 25703327 , 7791904 , 9003773 , (Europe PMC )0.73 BioGRID, IntAct, MINT RPL11 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid, two hybrid array association, physical, physical association 12842086 , 14612427 , 15308643 , 15314173 , 15314174 , 16803902 , 17110929 , 17116689 , 17242401 , 17310983 , 17373842 , 18426907 , 18560357 , 19713960 , 20547751 , 20554519 , 21097889 , 21399665 , 21804542 , 21903592 , 21988832 , 23169665 , 23507139 , 23728348 , 23776465 , 26908445 , 27856536 , (Europe PMC )0.91 BioGRID, IntAct, MINT RPL23 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, two hybrid physical, physical association 15308643 , 15314173 , 17110929 , 17116689 , 17310983 , 20547751 , 23169665 , (Europe PMC )0.57 BioGRID, IntAct, MINT RPL5 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation association, physical, physical association 14612427 , 15308643 , 15314173 , 15314174 , 17110929 , 17116689 , 17242401 , 17373842 , 18426907 , 18560357 , 20547751 , 20554519 , 21097889 , 21399665 , 21925390 , 23169665 , 26908445 , 7935455 , (Europe PMC )0.67 BioGRID, IntAct, MINT RYBP Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid association, physical, physical association 19098711 , (Europe PMC )0.62 BioGRID, IntAct, MINT S100A1 Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT S100A2 Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT S100A4 Reconstituted Complex, competition binding, molecular sieving, surface plasmon resonance direct interaction, physical, physical association 20591429 , (Europe PMC )0.61 BioGRID, IntAct, MINT S100A6 Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT S100B Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT SFN Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation association, physical 17546054 , 19166854 , (Europe PMC )0.35 BioGRID, IntAct, MINT SNAI1 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 20385133 , 22128911 , (Europe PMC )0.40 BioGRID, IntAct, MINT TP53 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-RNA, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-fractionation, Co-localization, FRET, Far Western, PCA, Phenotypic Suppression, Protein-RNA, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, chromatin immunoprecipitation assay, classical fluorescence spectroscopy, cosedimentation in solution, enzyme linked immunosorbent assay, fluorescence polarization spectroscopy, isothermal titration calorimetry, molecular sieving, nuclear magnetic resonance, peptide array, proximity ligation assay, pull down, surface plasmon resonance, two hybrid, ubiquitinase assay, x-ray crystallography association, direct interaction, genetic, physical, physical association, ubiquitination reaction 10196247 , 10202144 , 10347217 , 10435614 , 10488081 , 10561590 , 10562557 , 10640350 , 10681559 , 10722742 , 10766163 , 10827196 , 10889512 , 10980696 , 11046142 , 11070080 , 11094089 , 11112690 , 11178989 , 11284721 , 11285227 , 11351297 , 11384992 , 11431470 , 11486026 , 11562347 , 11572869 , 11597128 , 11697899 , 11709713 , 11713287 , 11713288 , 11714701 , 11744695 , 11839577 , 11925449 , 12167711 , 12208736 , 12381304 , 12426395 , 12552135 , 12612087 , 12620407 , 12690203 , 12842086 , 12897156 , 12915590 , 12944468 , 14499615 , 14517261 , 14559824 , 14596917 , 14612427 , 14671306 , 14702041 , 14704432 , 14741215 , 15001357 , 15013777 , 15053879 , 15058298 , 15064742 , 15094782 , 15122315 , 15144954 , 15154850 , 15210108 , 15242646 , 15247280 , 15280377 , 15295102 , 15308643 , 15313915 , 15358376 , 15542844 , 15550400 , 15558054 , 15604276 , 15824742 , 15848166 , 15908921 , 15933712 , 15950904 , 16023600 , 16055726 , 16107876 , 1614537 , 16152627 , 16159876 , 16173922 , 16201274 , 16212962 , 16215989 , 16331255 , 16338390 , 16414131 , 16432196 , 16547496 , 16579792 , 16595680 , 16624812 , 16678796 , 16751805 , 16845383 , 16857591 , 16861890 , 16866370 , 16870621 , 16905769 , 16964247 , 17056014 , 17080083 , 17098746 , 17116689 , 17139261 , 17159902 , 17268548 , 17290220 , 17297477 , 17301054 , 17302414 , 17310983 , 17318220 , 17347673 , 17363365 , 17369817 , 17380154 , 17426254 , 17438265 , 17470788 , 17525743 , 17591690 , 17616658 , 17666403 , 17848574 , 17875722 , 17908790 , 17936559 , 17989425 , 18061646 , 18172499 , 18223694 , 18234963 , 18309296 , 18316739 , 18332869 , 18467333 , 18485870 , 18541670 , 18566590 , 18604177 , 18665269 , 18813780 , 18815136 , 18981217 , 19033382 , 19071110 , 19081178 , 19085961 , 19098711 , 19106616 , 19153082 , 19160491 , 19166840 , 19188367 , 19223463 , 19234109 , 19255450 , 19303885 , 19305137 , 19332559 , 19357310 , 19411066 , 19411846 , 19483087 , 19568783 , 19590512 , 19597489 , 19656744 , 19805293 , 19816404 , 19837670 , 19857530 , 19941302 , 20047188 , 20080206 , 20124408 , 20173098 , 20174603 , 20234175 , 20235143 , 20395212 , 20479273 , 20484049 , 20542919 , 20570896 , 20588255 , 20591429 , 20591651 , 20639885 , 20657550 , 20659896 , 20660730 , 20694676 , 20705607 , 20708156 , 20837658 , 20847049 , 20959462 , 20962272 , 21060154 , 21071676 , 21075307 , 21084285 , 21084564 , 21088494 , 21098709 , 21132010 , 21149449 , 21170087 , 21261729 , 21268072 , 21316347 , 21317885 , 21454483 , 21465263 , 21471462 , 21478269 , 21561866 , 21572037 , 21584881 , 21726810 , 21750659 , 21857681 , 21887275 , 21925390 , 21965653 , 21986495 , 21988832 , 22032989 , 22083959 , 22084066 , 22085928 , 22103682 , 22124327 , 22157679 , 22227409 , 22262183 , 22266850 , 22266868 , 22301280 , 22318540 , 22331460 , 22366412 , 22374672 , 22389628 , 22391559 , 22411991 , 22444248 , 22474335 , 22487680 , 22510990 , 22525275 , 22575647 , 22588298 , 22653443 , 22659184 , 22737255 , 22807444 , 22819825 , 22912717 , 22914926 , 22916255 , 22920093 , 22948151 , 22975381 , 23134341 , 23150668 , 23169665 , 23201157 , 23246961 , 23252402 , 23261415 , 23318437 , 23370271 , 23402884 , 23443559 , 23483203 , 23572512 , 23609977 , 23671280 , 23728348 , 23776060 , 23776465 , 23802716 , 23826318 , 23880345 , 23946421 , 24127580 , 24200963 , 24207125 , 24240685 , 24314634 , 24361594 , 24413661 , 24462112 , 24488098 , 24567357 , 24621507 , 24643130 , 24659749 , 24667498 , 24842904 , 24926618 , 24980433 , 24998844 , 25103245 , 25156994 , 25168242 , 25241761 , 25277184 , 25283148 , 25312347 , 25313037 , 25362358 , 25384516 , 25417702 , 25464845 , 25512388 , 25543083 , 25609649 , 25624478 , 25637791 , 25739118 , 25954860 , 26001071 , 26186194 , 26203195 , 26238070 , 26350565 , 26475964 , 26540344 , 26556313 , 26578655 , 26673821 , 26720344 , 26876197 , 26882543 , 26883110 , 26908445 , 27031960 , 27106262 , 27129163 , 27215386 , 27282385 , 27308622 , 27336364 , 27462439 , 27543608 , 27807478 , 27811966 , 27856536 , 27886165 , 27893708 , 28082682 , 28223335 , 28362432 , 28394340 , 28514442 , 28542145 , 28549433 , 28553961 , 28605833 , 7686617 , 7689721 , 8058315 , 8875929 , 9131587 , 9223638 , 9271120 , 9278461 , 9363941 , 9450543 , 9529249 , 9582019 , 9724739 , 9809062 , 9824166 , (Europe PMC )0.99 BioGRID, IntAct, MINT UBC Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, physical, physical association 16023600 , 17170710 , 17290220 , 18566590 , 19098711 , 19166840 , 24143256 , (Europe PMC )0.82 BioGRID, IntAct, MINT USP2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down physical, physical association 17290220 , (Europe PMC )0.40 BioGRID, IntAct, MINT USP7 Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, classical fluorescence spectroscopy, isothermal titration calorimetry, molecular sieving, pull down, x-ray crystallography association, direct interaction, physical, physical association 15916963 , 16402859 , 16474402 , 16845383 , 16943424 , 17380154 , 17936559 , 18566590 , 20713061 , 20816748 , 22056774 , 24462112 , 26238070 , 26460617 , 26971997 , 27452404 , 28196907 , (Europe PMC )0.96 BioGRID, IntAct, MINT YY1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 15210108 , 22659184 , (Europe PMC )0.40 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABL1 Affinity Capture-Western, Biochemical Activity, Protein-peptide, Reconstituted Complex physical 12110584 , 25624478 , (Europe PMC )NA BioGRID ABL2 Protein-peptide physical 25624478 , (Europe PMC )NA BioGRID ACACA Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID ACTB Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID ADRB2 Biochemical Activity physical 11588219 , (Europe PMC )NA BioGRID AGPS Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID AKT1 Affinity Capture-Western, Biochemical Activity, Co-localization, anti bait coimmunoprecipitation, experimental interaction detection, protein kinase assay, proximity ligation assay association, phosphorylation reaction, physical, physical association 11715018 , 11923280 , 12145204 , 15527798 , 18332867 , 19166854 , 20856200 , 21930127 , 23397142 , 25241761 , (Europe PMC )0.83 BioGRID, IntAct, MINT ALDH16A1 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID ANAPC2 Affinity Capture-Western physical 24804778 , (Europe PMC )NA BioGRID ANG Affinity Capture-Western physical 22266868 , (Europe PMC )NA BioGRID ANKRD17 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct APEX1 Affinity Capture-Western, Biochemical Activity physical 19219073 , (Europe PMC )NA BioGRID APP Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct AR Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 12145204 , 15640443 , 17974989 , 18332867 , 21157430 , 23132866 , 26196320 , 26411689 , 27903893 , 28151478 , 28708672 , (Europe PMC )0.40 BioGRID, IntAct ARHGAP45 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID ARHGEF6 display technology physical association 20195357 , (Europe PMC )0.40 IntAct ARIH2 Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 22819825 , 22940738 , (Europe PMC )0.35 BioGRID, IntAct, MINT ARNTL2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ARRB1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 11588219 , 12538596 , 15878855 , 18544533 , 19879840 , 21081496 , 21466165 , 21857681 , (Europe PMC )0.64 BioGRID, IntAct ARRB2 Affinity Capture-Western, Biochemical Activity, Co-localization, FRET, Two-hybrid, coimmunoprecipitation, experimental interaction detection, pull down, two hybrid, two hybrid array direct interaction, physical, physical association, ubiquitination reaction 11588219 , 12488444 , 12538596 , 15878855 , 17984062 , 18544533 , 21081496 , 21389118 , 21466165 , 21988832 , 26545496 , (Europe PMC )0.71 BioGRID, IntAct, MINT ATF3 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 15933712 , 20592017 , (Europe PMC )NA BioGRID ATF4 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, confocal microscopy, two hybrid colocalization, physical, physical association 21988832 , 27264869 , (Europe PMC )0.44 BioGRID, IntAct ATM Biochemical Activity physical 22976441 , 27462439 , (Europe PMC )NA BioGRID ATP2A2 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID AURKA Affinity Capture-Western, Biochemical Activity physical 24240108 , (Europe PMC )NA BioGRID BAIAP2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct BAIAP2L1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 21887275 , (Europe PMC )NA BioGRID BANP Affinity Capture-Western, Reconstituted Complex physical 19303885 , 25086032 , (Europe PMC )NA BioGRID BC032729 anti bait coimmunoprecipitation, nucleic acid uv cross-linking assay physical association 19411066 , (Europe PMC )0.40 IntAct BHLHE40 anti tag coimmunoprecipitation physical association 17347673 , (Europe PMC )0.40 IntAct, MINT BRINP1 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID BTRC Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down physical, physical association 20708156 , (Europe PMC )0.59 BioGRID, IntAct BUB1B Affinity Capture-Western physical 22566641 , (Europe PMC )NA BioGRID CANX Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID CASP2 Biochemical Activity, protease assay physical, protein cleavage 21726810 , (Europe PMC )0.44 BioGRID, IntAct CASP3 Biochemical Activity, Co-localization, protease assay, proximity ligation assay physical, physical association, protein cleavage 21726810 , 24842904 , 25241761 , 9278461 , 9840926 , (Europe PMC )0.44, 0.61 BioGRID, IntAct CCAR1 Affinity Capture-Western physical 18382127 , (Europe PMC )NA BioGRID CCAR2 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID CCND1 Affinity Capture-Western physical 27129163 , (Europe PMC )NA BioGRID CCNG1 Affinity Capture-Western, Reconstituted Complex physical 12556559 , (Europe PMC )NA BioGRID CDH1 Affinity Capture-Western, Reconstituted Complex physical 16980628 , 25086032 , (Europe PMC )NA BioGRID CDK5RAP3 Affinity Capture-Western physical 16173922 , (Europe PMC )NA BioGRID CDK9 Affinity Capture-Western physical 19617712 , (Europe PMC )NA BioGRID CDKN1A Affinity Capture-MS, Affinity Capture-Western, Co-localization, FRET, Reconstituted Complex, proximity ligation assay physical, physical association 14633995 , 14761977 , 17373842 , 20086099 , 20308078 , 25241761 , (Europe PMC )0.40 BioGRID, IntAct CDKN2A Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, Two-hybrid physical 10801444 , 10822382 , 10871849 , 11223036 , 12085228 , 12167711 , 12630860 , 14612427 , 15355988 , 16107876 , 16173922 , 17116689 , 17426254 , 17909018 , 18418067 , 18467333 , 18541670 , 18583933 , 18813780 , 19049976 , 20395212 , 20713054 , 21133853 , 22120712 , 24769896 , 25809483 , 9529248 , 9529249 , 9653180 , 9724636 , (Europe PMC )NA BioGRID CDKN2A anti bait coimmunoprecipitation, coimmunoprecipitation, fluorescence microscopy association, colocalization, physical association 12740913 , 17909018 , 18583933 , 19166854 , 20713054 , (Europe PMC )0.81 IntAct, MINT CDKN2AIP Affinity Capture-Western physical 17460193 , 18292944 , (Europe PMC )NA BioGRID CDKN2B anti bait coimmunoprecipitation association 17373842 , (Europe PMC )0.35 IntAct CENPX Affinity Capture-Western physical 17347673 , (Europe PMC )NA BioGRID CHEK2 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, experimental interaction detection, pull down direct interaction, phosphorylation reaction, physical, physical association 15862297 , 16943424 , 19176998 , (Europe PMC )0.66 BioGRID, IntAct, MINT CHRM3 display technology physical association 20195357 , (Europe PMC )0.40 IntAct CLPB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CLSTN1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct CLU Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct CMSS1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID COP1 Affinity Capture-Western physical 20333547 , (Europe PMC )NA BioGRID COPS5 Affinity Capture-Western, Reconstituted Complex physical 17879958 , (Europe PMC )NA BioGRID CREBBP Affinity Capture-RNA, Affinity Capture-Western, Biochemical Activity physical 15013777 , 21149449 , 22349818 , (Europe PMC )NA BioGRID CRTC2 Affinity Capture-Western physical 27362806 , (Europe PMC )NA BioGRID CRTC3 Affinity Capture-Western physical 27362806 , (Europe PMC )NA BioGRID CSNK1A1 Affinity Capture-Western, anti tag coimmunoprecipitation, pull down physical, physical association 19759023 , 20708156 , 22916255 , (Europe PMC )0.52 BioGRID, IntAct CSNK1D Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, fluorescence microscopy, pull down colocalization, physical, physical association 16870621 , 20708156 , 22976441 , (Europe PMC )0.61 BioGRID, IntAct CSNK1E anti tag coimmunoprecipitation, pull down physical association 20708156 , (Europe PMC )0.52 IntAct CSNK2A1 Biochemical Activity physical 10561590 , 11284721 , (Europe PMC )NA BioGRID CSNK2A2 Biochemical Activity physical 10561590 , (Europe PMC )NA BioGRID CSNK2B Biochemical Activity physical 10561590 , (Europe PMC )NA BioGRID CTBP1 Affinity Capture-Western, Far Western physical 12867035 , (Europe PMC )NA BioGRID CTBP2 Affinity Capture-Western, Reconstituted Complex physical 12867035 , 21057548 , (Europe PMC )NA BioGRID CUL1 Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 20708156 , 24804778 , (Europe PMC )0.52 BioGRID, IntAct CUL4A Affinity Capture-Western physical 16861890 , 22032989 , (Europe PMC )NA BioGRID CUL4B Affinity Capture-Western physical 22032989 , (Europe PMC )NA BioGRID CWC25 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct DAAM2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct DAPK1 Protein-peptide physical 15001356 , (Europe PMC )NA BioGRID DAPK3 Biochemical Activity, Co-localization, Protein-peptide physical 15001356 , 23146908 , (Europe PMC )NA BioGRID DAXX Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, display technology, fluorescence microscopy, fluorescence technology, nuclear magnetic resonance, pull down association, colocalization, direct interaction, physical, physical association 15364927 , 16845383 , 18566590 , 18583933 , 20195357 , 21134643 , 23038753 , 23405218 , (Europe PMC )0.44, 0.89 BioGRID, IntAct, MINT DCAF8 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID DCD Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17373842 , (Europe PMC )0.35 BioGRID, IntAct DDB1 Affinity Capture-RNA, Affinity Capture-Western physical 22032989 , 24798327 , (Europe PMC )NA BioGRID DDX17 Affinity Capture-Luminescence physical 17226766 , (Europe PMC )NA BioGRID DDX24 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 24980433 , (Europe PMC )NA BioGRID DDX42 Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID DDX5 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID DET1 Affinity Capture-Western physical 17452440 , (Europe PMC )NA BioGRID DHFR Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid physical 18451149 , (Europe PMC )NA BioGRID DHRS2 Affinity Capture-MS, Affinity Capture-Western physical 20547751 , (Europe PMC )NA BioGRID DHX9 Affinity Capture-MS, Affinity Capture-RNA physical 24147044 , 24798327 , (Europe PMC )NA BioGRID DIRAS3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID DLAT Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID DLG4 Affinity Capture-Western, Reconstituted Complex, pull down association, direct interaction, physical 23260144 , (Europe PMC )0.52 BioGRID, IntAct DNAJB1 Affinity Capture-Western, Two-hybrid physical 24361594 , (Europe PMC )NA BioGRID DNAJB4 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct DTL Affinity Capture-Western physical 16861890 , (Europe PMC )NA BioGRID DYRK2 Affinity Capture-Western, Biochemical Activity physical 19965871 , (Europe PMC )NA BioGRID E2F1 Affinity Capture-Western, Biochemical Activity physical 16170383 , 18754770 , (Europe PMC )NA BioGRID EBI-1800051 electrophoretic mobility shift assay, electrophoretic mobility supershift assay association 18485870 , (Europe PMC )0.46 IntAct EBI-4399559 anti bait coimmunoprecipitation, comigration in sds page direct interaction, physical association 19805293 , 22056774 , (Europe PMC )0.61 IntAct EDC4 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID EED Affinity Capture-Western physical 26748827 , (Europe PMC )NA BioGRID EEF1A1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy, pull down association, direct interaction, physical, physical association 17373842 , 23260144 , (Europe PMC )0.71 BioGRID, IntAct EEF1G display technology physical association 20195357 , (Europe PMC )0.40 IntAct EEF2 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID EFTUD2 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID EGR1 Affinity Capture-Western physical 15225550 , (Europe PMC )NA BioGRID EHMT1 Affinity Capture-Western physical 20588255 , (Europe PMC )NA BioGRID EID1 Affinity Capture-Western, Biochemical Activity physical 11073989 , 24167073 , (Europe PMC )NA BioGRID EIF2AK1 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID EIF3B Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID ELF4 Affinity Capture-Western physical 25081543 , (Europe PMC )NA BioGRID EP300 Affinity Capture-Western, Biochemical Activity, Co-fractionation, Reconstituted Complex physical 11070080 , 15013777 , 15154850 , 20234175 , 28196907 , 9809062 , (Europe PMC )NA BioGRID EPS15 display technology physical association 20195357 , (Europe PMC )0.40 IntAct ERBB3 Affinity Capture-Western physical 21930127 , (Europe PMC )NA BioGRID ERBB4 Affinity Capture-Western physical 20858735 , (Europe PMC )NA BioGRID ERCC6 Affinity Capture-Western physical 22032989 , (Europe PMC )NA BioGRID ERCC8 Affinity Capture-Western physical 22032989 , (Europe PMC )NA BioGRID ERICH3 display technology physical association 20195357 , (Europe PMC )0.40 IntAct ESR1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down, two hybrid physical, physical association 10766163 , 11178989 , 12897156 , 17545634 , (Europe PMC )0.51 BioGRID, IntAct ESR2 Affinity Capture-Western physical 22349818 , (Europe PMC )NA BioGRID ESYT1 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID EXOSC6 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID EZH2 Affinity Capture-Western physical 26748827 , (Europe PMC )NA BioGRID EZR Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct FAM171A1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct FBXO31 Affinity Capture-Western, Biochemical Activity physical 26124108 , (Europe PMC )NA BioGRID FBXW11 Affinity Capture-Western, anti tag coimmunoprecipitation, pull down physical, physical association 20708156 , (Europe PMC )0.52 BioGRID, IntAct FBXW7 pull down physical association 20708156 , (Europe PMC )0.40 IntAct FEZ1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct FHIT Affinity Capture-Western physical 15313915 , (Europe PMC )NA BioGRID FHL2 Affinity Capture-Western, Reconstituted Complex physical 26973248 , (Europe PMC )NA BioGRID FKBP1A Affinity Capture-Western, Reconstituted Complex physical 27617579 , (Europe PMC )NA BioGRID FKBP3 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, two hybrid physical, physical association 19166840 , (Europe PMC )0.51 BioGRID, IntAct, MINT FOXO1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 19321440 , 27412556 , (Europe PMC )NA BioGRID FOXO3 Affinity Capture-RNA, Affinity Capture-Western physical 18204439 , 19321440 , 27886165 , (Europe PMC )NA BioGRID FOXO4 Affinity Capture-Western, Biochemical Activity physical 18665269 , 20874444 , 21525355 , (Europe PMC )NA BioGRID FUBP1 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID G3BP2 Affinity Capture-Western, Reconstituted Complex physical 17297477 , (Europe PMC )NA BioGRID GABRA2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct GADD45A Affinity Capture-Western, Biochemical Activity physical 23563151 , (Europe PMC )NA BioGRID GAPDH Affinity Capture-MS physical 17373842 , (Europe PMC )NA BioGRID GAPDHS anti bait coimmunoprecipitation association 17373842 , (Europe PMC )0.35 IntAct GATA3 Affinity Capture-Western physical 15975924 , (Europe PMC )NA BioGRID GCAT Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GNAS Affinity Capture-Western physical 18948082 , (Europe PMC )NA BioGRID GNL2 anti tag coimmunoprecipitation physical association 21132010 , (Europe PMC )0.40 IntAct GNL3 Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation physical, physical association 18426907 , 19033382 , 21132010 , 24769896 , (Europe PMC )0.40 BioGRID, IntAct GNL3L Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 21132010 , (Europe PMC )0.56 BioGRID, IntAct GORAB Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 20598683 , (Europe PMC )0.52 BioGRID, IntAct, MINT GRK2 Affinity Capture-Luminescence, Affinity Capture-Western physical 17006543 , 21081496 , 26228571 , (Europe PMC )NA BioGRID GRK2 anti bait coimmunoprecipitation physical association 17006543 , (Europe PMC )0.40 IntAct, MINT GSK3B Affinity Capture-Western, Biochemical Activity physical 16055726 , (Europe PMC )NA BioGRID GSN Affinity Capture-MS physical 17373842 , (Europe PMC )NA BioGRID GSTP1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct GTF2E2 Reconstituted Complex physical 9271120 , (Europe PMC )NA BioGRID GTF2I Affinity Capture-MS, Affinity Capture-RNA, Affinity Capture-Western physical 24147044 , 24798327 , 26656605 , (Europe PMC )NA BioGRID HCK Protein-peptide physical 25624478 , (Europe PMC )NA BioGRID HDAC1 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 12426395 , 15640443 , (Europe PMC )NA BioGRID HEXIM1 Affinity Capture-Western physical 19617712 , (Europe PMC )NA BioGRID HEY1 Reconstituted Complex physical 27129302 , (Europe PMC )NA BioGRID HIF1A Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid physical 10640274 , 12606552 , 19696166 , 25447306 , 25535359 , (Europe PMC )NA BioGRID HIPK1 fluorescence microscopy colocalization 22173032 , (Europe PMC )0.27 IntAct, MINT HIPK2 Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, experimental interaction detection, pull down phosphorylation reaction, physical, physical association 16212962 , 17349959 , 23826318 , (Europe PMC )0.62 BioGRID, IntAct, MINT HIST1H2BJ Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HIST2H2BE Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 15546622 , (Europe PMC )NA BioGRID HIST3H3 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 20588255 , (Europe PMC )NA BioGRID HLA-DMB Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct HMGN1 Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID HNF4A Affinity Capture-Western physical 22197810 , (Europe PMC )NA BioGRID HNRNPD Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID HNRNPK Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 19249676 , 22825850 , 23092970 , (Europe PMC )0.59 BioGRID, IntAct, MINT HNRNPM Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID HNRNPU Affinity Capture-MS, Affinity Capture-RNA physical 24147044 , 24798327 , (Europe PMC )NA BioGRID HRNR Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID HSP90AA1 Affinity Capture-MS, Affinity Capture-Western, Co-purification, Protein-peptide, Reconstituted Complex physical 15001356 , 15001357 , 20540933 , 24147044 , (Europe PMC )NA BioGRID HSP90AB1 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID HSP90B1 Affinity Capture-Western, Reconstituted Complex, display technology physical, physical association 20195357 , 25637791 , (Europe PMC )0.40 BioGRID, IntAct HSPA4 Affinity Capture-Western physical 20540933 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS, Affinity Capture-Western, display technology physical, physical association 20195357 , 20540933 , 24147044 , (Europe PMC )0.40 BioGRID, IntAct IARS Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID IER2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID IER3 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 26973248 , (Europe PMC )NA BioGRID IFI16 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID IGF1R Affinity Capture-Western, Biochemical Activity, Co-localization, display technology, proximity ligation assay physical, physical association 12821780 , 18632619 , 19165858 , 20195357 , 25241761 , 28092675 , (Europe PMC )0.59 BioGRID, IntAct IGF2BP3 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID ILF3 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID IPO7 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID IRF1 Affinity Capture-Western, Biochemical Activity, Protein-peptide, Reconstituted Complex physical 23134341 , 24583282 , 24721577 , 27795392 , (Europe PMC )NA BioGRID IRF2 Affinity Capture-Western, Biochemical Activity, Protein-peptide physical 19032150 , 24583282 , (Europe PMC )NA BioGRID ITCH Affinity Capture-Western physical 21093410 , 26025930 , (Europe PMC )NA BioGRID IYD Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID JAK1 Affinity Capture-Western physical 24413661 , 27362806 , (Europe PMC )NA BioGRID JMY anti bait coimmunoprecipitation physical association 17170761 , (Europe PMC )0.40 IntAct, MINT JUN Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct JUND Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct KARS Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID KAT2B Affinity Capture-Western, Biochemical Activity, Phenotypic Suppression, Reconstituted Complex genetic, physical 12068014 , 14769800 , 21060154 , 28286521 , (Europe PMC )NA BioGRID KAT5 Affinity Capture-Western, Reconstituted Complex physical 11927554 , 18264029 , 18499675 , 19150978 , (Europe PMC )NA BioGRID KIAA1551 Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID KIF5A display technology physical association 20195357 , (Europe PMC )0.40 IntAct KPNA1 Reconstituted Complex physical 28196907 , (Europe PMC )NA BioGRID KPNA6 Affinity Capture-Western, Reconstituted Complex physical 28196907 , (Europe PMC )NA BioGRID KRT14 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17373842 , (Europe PMC )0.35 BioGRID, IntAct KRT2 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID LAMP2 Affinity Capture-Western physical 20540933 , (Europe PMC )NA BioGRID LATS1 Affinity Capture-Western physical 22195963 , (Europe PMC )NA BioGRID LATS2 Affinity Capture-Western, Two-hybrid physical 17015431 , (Europe PMC )NA BioGRID LMO7 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MAGEA2 Affinity Capture-Western, Protein-peptide, Reconstituted Complex physical 26001071 , (Europe PMC )NA BioGRID MAK16 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAP1LC3A Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID MAP2 Biochemical Activity, display technology physical, physical association 20195357 , 24124579 , (Europe PMC )0.40 BioGRID, IntAct MAP4K4 display technology physical association 20195357 , (Europe PMC )0.40 IntAct MAPKAPK2 Biochemical Activity physical 15688025 , (Europe PMC )NA BioGRID MARS display technology physical association 20195357 , (Europe PMC )0.40 IntAct MDC1 Affinity Capture-Western, Protein-peptide physical 14578343 , 18471438 , (Europe PMC )NA BioGRID MDM2 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-fractionation, Co-localization, PCA, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid array physical, physical association 10722742 , 11724934 , 14517261 , 14596917 , 15001357 , 15280377 , 15950904 , 16331255 , 16338389 , 16714300 , 16803902 , 16845383 , 16905769 , 16965791 , 17159902 , 17170710 , 17301054 , 17347673 , 17373842 , 17426254 , 17936559 , 17989425 , 19132120 , 19166840 , 19619542 , 19683495 , 20479273 , 20484049 , 20705607 , 21060154 , 21084285 , 22333590 , 22493164 , 22989009 , 23671280 , 23871895 , 24147044 , 24755078 , 24804778 , 25659040 , 25809483 , 25888903 , 26720344 , 27215386 , 28166445 , 28196907 , (Europe PMC )0.74 BioGRID, IntAct, MINT MDM4 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-localization, Co-purification, FRET, PCA, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, imaging technique, pull down, two hybrid, two hybrid array association, colocalization, physical, physical association 10218570 , 10608892 , 10827196 , 11606419 , 12370303 , 12393902 , 12483531 , 12860999 , 12874296 , 15604276 , 16055726 , 16227609 , 17159902 , 17301054 , 17616658 , 18219319 , 18566590 , 19432880 , 19619542 , 19683495 , 19838211 , 20473904 , 20484049 , 20705607 , 20724842 , 21925390 , 21988832 , 22120712 , 22266850 , 22333590 , 22493164 , 22902369 , 23028042 , 23671280 , 23946421 , 24755078 , 24813712 , 25105592 , 25384516 , 25512388 , 25659040 , 25703327 , 25809483 , 25825738 , 26001071 , 26359458 , 26720344 , 27215386 , 27617579 , 27621617 , 28514442 , (Europe PMC )0.93 BioGRID, IntAct, MINT MEA1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct MED1 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down physical, physical association 15848166 , (Europe PMC )0.52 BioGRID, IntAct, MINT MGEA5 display technology physical association 20195357 , (Europe PMC )0.40 IntAct MKRN3 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct MRE11 Affinity Capture-MS, Affinity Capture-Western physical 15734743 , (Europe PMC )NA BioGRID MRPS33 display technology physical association 20195357 , (Europe PMC )0.40 IntAct MS4A1 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID MSI2 Affinity Capture-Western physical 28223335 , (Europe PMC )NA BioGRID MTA1 Affinity Capture-Western physical 19837670 , (Europe PMC )NA BioGRID MTBP Affinity Capture-Western, Phenotypic Suppression, Reconstituted Complex, Two-hybrid genetic, physical 10906133 , 15632057 , (Europe PMC )NA BioGRID MYD88 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MYDGF Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID NACA Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct NAP1L1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct NAT10 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 26882543 , (Europe PMC )NA BioGRID NBN Affinity Capture-MS, Affinity Capture-Western physical 15734743 , 18541670 , (Europe PMC )NA BioGRID NCL Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, display technology, far western blotting, pull down direct interaction, physical, physical association 16751805 , 20195357 , 22103682 , 24147044 , (Europe PMC )0.71 BioGRID, IntAct, MINT NDUFA12 display technology physical association 20195357 , (Europe PMC )0.40 IntAct NEDD4 Affinity Capture-Western, Biochemical Activity, Protein-peptide physical 15001356 , 24413081 , (Europe PMC )NA BioGRID NEFM display technology physical association 20195357 , (Europe PMC )0.40 IntAct NEK9 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID NGFR Affinity Capture-Western, Reconstituted Complex physical 27282385 , (Europe PMC )NA BioGRID NLK Affinity Capture-Western physical 24926618 , (Europe PMC )NA BioGRID NME2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 21504894 , (Europe PMC )NA BioGRID NOC2L Affinity Capture-Western, Co-localization, Reconstituted Complex physical 24413661 , (Europe PMC )NA BioGRID NOLC1 Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID NOP53 Two-hybrid physical 21988832 , (Europe PMC )NA BioGRID NOP53 two hybrid physical association 21988832 , (Europe PMC )0.37 IntAct NOTCH1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 22128911 , 23252402 , (Europe PMC )NA BioGRID NOTCH4 Affinity Capture-Western physical 21402876 , (Europe PMC )NA BioGRID NPIPB3 Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID NPM1 Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, direct interaction, physical, physical association 15144954 , 22510990 , 23039052 , (Europe PMC )0.35, 0.70 BioGRID, IntAct, MINT NR0B2 Affinity Capture-Western, Co-localization, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 22197810 , 22575647 , (Europe PMC )0.52 BioGRID, IntAct, MINT NR3C1 Affinity Capture-Western physical 11562347 , (Europe PMC )NA BioGRID NSD2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct NUCKS1 Biochemical Activity, display technology physical, physical association 20195357 , 24124579 , (Europe PMC )0.40 BioGRID, IntAct NUDT9 display technology physical association 20195357 , (Europe PMC )0.40 IntAct NUMB Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid physical 12646252 , 16678796 , 18172499 , 22337874 , 23252402 , 27106262 , 28223335 , (Europe PMC )NA BioGRID NUMB anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, direct interaction, physical association 18172499 , (Europe PMC )0.40, 0.62 IntAct OGDH Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID OGDHL Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID OTUB1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, direct interaction, physical association 22124327 , (Europe PMC )0.63 IntAct, MINT PA2G4 Affinity Capture-Western physical 21098709 , 21930127 , (Europe PMC )NA BioGRID PAK1IP1 Affinity Capture-Western physical 21097889 , (Europe PMC )NA BioGRID PAK6 Affinity Capture-Western, Biochemical Activity physical 23132866 , (Europe PMC )NA BioGRID PBX1 Biochemical Activity, Reconstituted Complex physical 23044487 , (Europe PMC )NA BioGRID PBXIP1 Affinity Capture-Western, Biochemical Activity physical 24488098 , (Europe PMC )NA BioGRID PCNA Affinity Capture-Western physical 16861890 , 20733054 , (Europe PMC )NA BioGRID PDCD5 Affinity Capture-Western physical 22914926 , (Europe PMC )NA BioGRID PDE4D Affinity Capture-Western, Biochemical Activity physical 19372219 , (Europe PMC )NA BioGRID PDGFB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PDIA3 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID PDLIM7 Affinity Capture-Western, Reconstituted Complex physical 21060154 , (Europe PMC )NA BioGRID PDS5A Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID PER2 Affinity Capture-Western physical 25103245 , (Europe PMC )NA BioGRID PFDN6 display technology physical association 20195357 , (Europe PMC )0.40 IntAct PGAM1 Affinity Capture-Western physical 24567357 , (Europe PMC )NA BioGRID PGAM2 Affinity Capture-Western, Biochemical Activity physical 24567357 , (Europe PMC )NA BioGRID PHF7 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct PHLDB3 Affinity Capture-Western, Reconstituted Complex physical 28008906 , (Europe PMC )NA BioGRID PIAS1 Biochemical Activity physical 12393906 , (Europe PMC )NA BioGRID PIM1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, protein kinase assay phosphorylation reaction, physical 18467333 , 19166854 , (Europe PMC )0.44 BioGRID, IntAct, MINT PIM2 protein kinase assay phosphorylation reaction 19166854 , (Europe PMC )0.44 IntAct, MINT PIM3 protein kinase assay phosphorylation reaction 19166854 , (Europe PMC )0.44 IntAct, MINT PKM Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, display technology physical, physical association 20195357 , 27264869 , (Europe PMC )0.40 BioGRID, IntAct PLK1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, protein kinase assay, pull down phosphorylation reaction, physical, physical association 19833129 , (Europe PMC )0.60 BioGRID, IntAct, MINT PML Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, imaging technique association, colocalization, direct interaction, physical, physical association 12759344 , 12915590 , 14507915 , 15195100 , 19150978 , 20972456 , 22869143 , 23169665 , (Europe PMC )0.58, 0.61 BioGRID, IntAct POLH Affinity Capture-Western physical 22056306 , (Europe PMC )NA BioGRID POT1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct PPAN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PPARD Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PPARG Affinity Capture-Western physical 26718225 , (Europe PMC )NA BioGRID PPIB Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID PPM1D Affinity Capture-Western, anti bait coimmunoprecipitation, phosphatase assay dephosphorylation reaction, physical, physical association 17936559 , (Europe PMC )0.54 BioGRID, IntAct PPP1CA Affinity Capture-Western physical 26636645 , (Europe PMC )NA BioGRID PPP2R5C anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical association 21460856 , (Europe PMC )0.50, 0.56 IntAct PRDM2 Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID PRPF6 display technology physical association 20195357 , (Europe PMC )0.40 IntAct PRRC2C display technology physical association 20195357 , (Europe PMC )0.40 IntAct PSMA3 Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 20308078 , 22659184 , (Europe PMC )0.40 BioGRID, IntAct, MINT PSMA6 anti bait coimmunoprecipitation physical association 22659184 , (Europe PMC )0.40 IntAct, MINT PSMA7 Affinity Capture-Western, Co-fractionation physical 16337594 , 20479273 , (Europe PMC )NA BioGRID PSMA8 Affinity Capture-Western physical 22659184 , (Europe PMC )NA BioGRID PSMB6 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 22659184 , (Europe PMC )0.40 BioGRID, IntAct, MINT PSMC1 Affinity Capture-Western physical 20479273 , (Europe PMC )NA BioGRID PSMC3 Affinity Capture-Western, Co-fractionation, Reconstituted Complex physical 20479273 , 22659184 , (Europe PMC )NA BioGRID PSMC5 Affinity Capture-Western, Co-fractionation, Reconstituted Complex physical 20479273 , (Europe PMC )NA BioGRID PSMC6 Affinity Capture-Western physical 20479273 , (Europe PMC )NA BioGRID PSMD1 Co-fractionation physical 20479273 , (Europe PMC )NA BioGRID PSMD10 Affinity Capture-Western, Reconstituted Complex physical 16023600 , 17904523 , 18332869 , (Europe PMC )NA BioGRID PSMD2 Affinity Capture-Western, Co-fractionation physical 18086887 , 20479273 , (Europe PMC )NA BioGRID PSMD4 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 19240029 , 20479273 , 22350919 , 22659184 , (Europe PMC )NA BioGRID PSME3 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, molecular sieving, pull down association, physical, physical association 18309296 , 21084564 , (Europe PMC )0.61 BioGRID, IntAct, MINT PTBP1 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID PTK2 Reconstituted Complex physical 18206965 , (Europe PMC )NA BioGRID PTPA Affinity Capture-Western physical 22525275 , (Europe PMC )NA BioGRID PTPRD display technology physical association 20195357 , (Europe PMC )0.40 IntAct PYHIN1 Affinity Capture-MS, Affinity Capture-Western physical 16479015 , 26186194 , (Europe PMC )NA BioGRID RAB8A Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID RABL6 Affinity Capture-Western, Reconstituted Complex physical 23572512 , (Europe PMC )NA BioGRID RAD23A Affinity Capture-Western, Reconstituted Complex physical 15064742 , (Europe PMC )NA BioGRID RAD50 Affinity Capture-MS, Affinity Capture-Western physical 15734743 , (Europe PMC )NA BioGRID RAD54B Affinity Capture-Western physical 25384516 , (Europe PMC )NA BioGRID RANBP1 Biochemical Activity physical 12393906 , (Europe PMC )NA BioGRID RANBP2 Biochemical Activity physical 12393906 , (Europe PMC )NA BioGRID RARA Affinity Capture-Western, Biochemical Activity physical 26776160 , (Europe PMC )NA BioGRID RARS Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID RASGRF1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct RASSF1 Affinity Capture-Western physical 18566590 , 23038753 , (Europe PMC )NA BioGRID RASSF1 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical association 18566590 , (Europe PMC )0.50 IntAct, MINT RASSF3 Affinity Capture-Western physical 22593196 , (Europe PMC )NA BioGRID RASSF5 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation physical, physical association 22173032 , (Europe PMC )0.40 BioGRID, IntAct, MINT RASSF6 Affinity Capture-Western physical 24003224 , (Europe PMC )NA BioGRID RB1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, physical, physical association 10078201 , 11433299 , 15044952 , 15485814 , 16337594 , 16374512 , 16510145 , 20871633 , 21990374 , 25703327 , 7791904 , 9003773 , (Europe PMC )0.73 BioGRID, IntAct, MINT RBBP6 Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation physical, physical association 17470788 , 24124579 , (Europe PMC )0.40 BioGRID, IntAct RBBP8 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID RBM38 Affinity Capture-RNA, Protein-RNA physical 22710720 , (Europe PMC )NA BioGRID RCHY1 Affinity Capture-Western, Reconstituted Complex physical 19483087 , 20333547 , (Europe PMC )NA BioGRID RCN2 display technology physical association 20195357 , (Europe PMC )0.40 IntAct RECQL Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID RELA Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid array physical, physical association 21988832 , 23839035 , (Europe PMC )0.37 BioGRID, IntAct RFFL Affinity Capture-Western physical 18382127 , (Europe PMC )NA BioGRID RFPL2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID RFWD3 Affinity Capture-Western, Reconstituted Complex physical 20173098 , (Europe PMC )NA BioGRID RFWD3 anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, direct interaction, physical association 20173098 , (Europe PMC )0.50, 0.59 IntAct RHOA Affinity Capture-Western physical 22907703 , (Europe PMC )NA BioGRID RIDA Two-hybrid physical 21988832 , (Europe PMC )NA BioGRID RIDA two hybrid physical association 21988832 , (Europe PMC )0.37 IntAct RLIM Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 26926424 , (Europe PMC )NA BioGRID RN5S1@ Affinity Capture-RNA physical 21925390 , (Europe PMC )NA BioGRID RNF10 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct RNF126 Two-hybrid physical 22493164 , (Europe PMC )NA BioGRID RNF126 two hybrid array physical association 22493164 , (Europe PMC )0.37 IntAct RNF2 Affinity Capture-Western physical 23318437 , (Europe PMC )NA BioGRID RNF8 Two-hybrid physical 22493164 , (Europe PMC )NA BioGRID RNF8 two hybrid array physical association 22493164 , (Europe PMC )0.37 IntAct RPL10A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID RPL11 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid, two hybrid array association, physical, physical association 12842086 , 14612427 , 15308643 , 15314173 , 15314174 , 16803902 , 17110929 , 17116689 , 17242401 , 17310983 , 17373842 , 18426907 , 18560357 , 19713960 , 20547751 , 20554519 , 21097889 , 21399665 , 21804542 , 21903592 , 21988832 , 23169665 , 23507139 , 23728348 , 23776465 , 26908445 , 27856536 , (Europe PMC )0.91 BioGRID, IntAct, MINT RPL15 Affinity Capture-MS, Biochemical Activity physical 24124579 , 28514442 , (Europe PMC )NA BioGRID RPL22L1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID RPL23 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, two hybrid physical, physical association 15308643 , 15314173 , 17110929 , 17116689 , 17310983 , 20547751 , 23169665 , (Europe PMC )0.57 BioGRID, IntAct, MINT RPL23A Affinity Capture-Western physical 26203195 , (Europe PMC )NA BioGRID RPL26 Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 18951086 , 20542919 , 21988832 , 23169665 , (Europe PMC )0.37 BioGRID, IntAct RPL27A display technology physical association 20195357 , (Europe PMC )0.40 IntAct RPL36A Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID RPL37 Affinity Capture-Western physical 23874713 , (Europe PMC )NA BioGRID RPL37A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RPL4 Affinity Capture-Western, Reconstituted Complex physical 26908445 , (Europe PMC )NA BioGRID RPL5 Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation association, physical, physical association 14612427 , 15308643 , 15314173 , 15314174 , 17110929 , 17116689 , 17242401 , 17373842 , 18426907 , 18560357 , 20547751 , 20554519 , 21097889 , 21399665 , 21925390 , 23169665 , 26908445 , 7935455 , (Europe PMC )0.67 BioGRID, IntAct, MINT RPL6 Affinity Capture-Western physical 24174547 , (Europe PMC )NA BioGRID RPS11 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RPS14 Affinity Capture-Western physical 22391559 , 22525275 , 23246961 , 27336364 , (Europe PMC )NA BioGRID RPS15 Affinity Capture-Western physical 23874713 , (Europe PMC )NA BioGRID RPS20 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, pull down association, physical 17373842 , 19656744 , 23874713 , (Europe PMC )0.53 BioGRID, IntAct RPS23 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID RPS25 Affinity Capture-Western physical 22777350 , (Europe PMC )NA BioGRID RPS26 Affinity Capture-Western physical 23728348 , (Europe PMC )NA BioGRID RPS27 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down direct interaction, physical, physical association 21170087 , (Europe PMC )0.60 BioGRID, IntAct RPS27A Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, two hybrid physical, physical association 21561866 , 21988832 , (Europe PMC )0.37 BioGRID, IntAct RPS27L Affinity Capture-Western, Reconstituted Complex physical 21170087 , (Europe PMC )NA BioGRID RPS27L anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, confocal microscopy, pull down colocalization, direct interaction, physical association 21170087 , (Europe PMC )0.62 IntAct RPS3 Affinity Capture-Western, FRET, Reconstituted Complex, anti bait coimmunoprecipitation, fluorescent resonance energy transfer, proximity ligation assay, pull down, ubiquitinase assay association, direct interaction, physical, physical association, ubiquitination reaction 19656744 , (Europe PMC )0.70 BioGRID, IntAct RPS6 Affinity Capture-Western physical 23169665 , (Europe PMC )NA BioGRID RPS6KB1 Affinity Capture-Western physical 20657550 , (Europe PMC )NA BioGRID RPS7 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid association, direct interaction, physical, physical association 17310983 , 19683495 , 21561866 , 21988832 , 23169665 , 23563151 , 28514442 , (Europe PMC )0.75 BioGRID, IntAct RRM1 Affinity Capture-Western physical 26228206 , (Europe PMC )NA BioGRID RRM2B Affinity Capture-Western, Biochemical Activity, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation physical, physical association 19015526 , (Europe PMC )0.40 BioGRID, IntAct RRP1 Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID RSL1D1 Affinity Capture-Western, Reconstituted Complex physical 27811966 , (Europe PMC )NA BioGRID RUNX3 Affinity Capture-Western physical 19808967 , (Europe PMC )NA BioGRID RUVBL2 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID RYBP Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down, two hybrid association, physical, physical association 19098711 , (Europe PMC )0.62 BioGRID, IntAct, MINT RYR2 Reconstituted Complex, display technology, tandem affinity purification physical, physical association 20195357 , (Europe PMC )0.52 BioGRID, IntAct S100A1 Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT S100A2 Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT S100A4 Reconstituted Complex, competition binding, molecular sieving, surface plasmon resonance direct interaction, physical, physical association 20591429 , (Europe PMC )0.61 BioGRID, IntAct, MINT S100A6 Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT S100B Reconstituted Complex, molecular sieving, surface plasmon resonance direct interaction, physical 20591429 , (Europe PMC )0.56 BioGRID, IntAct, MINT SDHC Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SEC63 display technology physical association 20195357 , (Europe PMC )0.40 IntAct SENP3 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 21316347 , (Europe PMC )NA BioGRID SESN2 Two-hybrid physical 21988832 , (Europe PMC )NA BioGRID SESN2 two hybrid physical association 21988832 , (Europe PMC )0.37 IntAct SET Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct SETD7 Reconstituted Complex physical 26317544 , (Europe PMC )NA BioGRID SETDB1 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SF3B1 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID SF3B3 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID SFN Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation association, physical 17546054 , 19166854 , (Europe PMC )0.35 BioGRID, IntAct, MINT SFPQ Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID SHARPIN Affinity Capture-Western physical 28063307 , (Europe PMC )NA BioGRID SHPK Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SIRT1 Affinity Capture-Western, Biochemical Activity physical 28196907 , (Europe PMC )NA BioGRID SIRT2 Biochemical Activity physical 28196907 , (Europe PMC )NA BioGRID SIRT3 Biochemical Activity physical 28196907 , (Europe PMC )NA BioGRID SIRT6 Affinity Capture-MS, Affinity Capture-Western physical 25074979 , 28196907 , 28514442 , (Europe PMC )NA BioGRID SIRT7 Affinity Capture-Western physical 28196907 , (Europe PMC )NA BioGRID SIVA1 Affinity Capture-Western physical 19590512 , 22343716 , (Europe PMC )NA BioGRID SMARCA2 Reconstituted Complex physical 25384516 , (Europe PMC )NA BioGRID SMARCA4 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID SMARCE1 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID SMC3 display technology physical association 20195357 , (Europe PMC )0.40 IntAct SMG7 Affinity Capture-Western, Reconstituted Complex physical 27462439 , (Europe PMC )NA BioGRID SMURF1 Affinity Capture-Western, Reconstituted Complex physical 20484049 , (Europe PMC )NA BioGRID SNAI1 Affinity Capture-Western, anti tag coimmunoprecipitation physical, physical association 20385133 , 22128911 , (Europe PMC )0.40 BioGRID, IntAct, MINT SNAI2 Affinity Capture-RNA, Affinity Capture-Western physical 23438693 , 26992741 , (Europe PMC )NA BioGRID SND1 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID SORBS2 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SOX4 Affinity Capture-Western physical 19234109 , (Europe PMC )NA BioGRID SP1 Affinity Capture-Western physical 22378045 , (Europe PMC )NA BioGRID SRC Affinity Capture-Western, Biochemical Activity, Protein-peptide, Reconstituted Complex physical 25624478 , (Europe PMC )NA BioGRID SREK1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct SRP19 display technology physical association 20195357 , (Europe PMC )0.40 IntAct SRSF11 Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID STX1A display technology physical association 20195357 , (Europe PMC )0.40 IntAct SUMO1 Biochemical Activity physical 12297306 , (Europe PMC )NA BioGRID SURF2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SUV39H1 Affinity Capture-Western physical 20588255 , 26971997 , (Europe PMC )NA BioGRID SUZ12 Affinity Capture-Western physical 26748827 , (Europe PMC )NA BioGRID TAB1 Affinity Capture-Western physical 23934659 , (Europe PMC )NA BioGRID TAF1 Affinity Capture-Western, Reconstituted Complex physical 17237821 , 9388200 , (Europe PMC )NA BioGRID TBCA display technology physical association 20195357 , (Europe PMC )0.40 IntAct TBP Reconstituted Complex, pull down physical, physical association 9271120 , 9388200 , (Europe PMC )0.40 BioGRID, IntAct TBRG1 Affinity Capture-Western physical 17110379 , (Europe PMC )NA BioGRID TCAP Affinity Capture-Western, Co-localization, Reconstituted Complex, Two-hybrid, two hybrid fragment pooling approach physical, physical association 16678796 , 23414517 , (Europe PMC )0.37 BioGRID, IntAct TERT Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 20453884 , 26370108 , (Europe PMC )NA BioGRID TFIP11 Affinity Capture-Western, Reconstituted Complex physical 26460617 , (Europe PMC )NA BioGRID TFRC Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID TMEM87A display technology physical association 20195357 , (Europe PMC )0.40 IntAct TOP1 Affinity Capture-MS, Protein-peptide physical 24147044 , 24583282 , (Europe PMC )NA BioGRID TP53 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-RNA, Affinity Capture-Western, Biochemical Activity, Co-crystal Structure, Co-fractionation, Co-localization, FRET, Far Western, PCA, Phenotypic Suppression, Protein-RNA, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, chromatin immunoprecipitation assay, classical fluorescence spectroscopy, cosedimentation in solution, enzyme linked immunosorbent assay, fluorescence polarization spectroscopy, isothermal titration calorimetry, molecular sieving, nuclear magnetic resonance, peptide array, proximity ligation assay, pull down, surface plasmon resonance, two hybrid, ubiquitinase assay, x-ray crystallography association, direct interaction, genetic, physical, physical association, ubiquitination reaction 10196247 , 10202144 , 10347217 , 10435614 , 10488081 , 10561590 , 10562557 , 10640350 , 10681559 , 10722742 , 10766163 , 10827196 , 10889512 , 10980696 , 11046142 , 11070080 , 11094089 , 11112690 , 11178989 , 11284721 , 11285227 , 11351297 , 11384992 , 11431470 , 11486026 , 11562347 , 11572869 , 11597128 , 11697899 , 11709713 , 11713287 , 11713288 , 11714701 , 11744695 , 11839577 , 11925449 , 12167711 , 12208736 , 12381304 , 12426395 , 12552135 , 12612087 , 12620407 , 12690203 , 12842086 , 12897156 , 12915590 , 12944468 , 14499615 , 14517261 , 14559824 , 14596917 , 14612427 , 14671306 , 14702041 , 14704432 , 14741215 , 15001357 , 15013777 , 15053879 , 15058298 , 15064742 , 15094782 , 15122315 , 15144954 , 15154850 , 15210108 , 15242646 , 15247280 , 15280377 , 15295102 , 15308643 , 15313915 , 15358376 , 15542844 , 15550400 , 15558054 , 15604276 , 15824742 , 15848166 , 15908921 , 15933712 , 15950904 , 16023600 , 16055726 , 16107876 , 1614537 , 16152627 , 16159876 , 16173922 , 16201274 , 16212962 , 16215989 , 16331255 , 16338390 , 16414131 , 16432196 , 16547496 , 16579792 , 16595680 , 16624812 , 16678796 , 16751805 , 16845383 , 16857591 , 16861890 , 16866370 , 16870621 , 16905769 , 16964247 , 17056014 , 17080083 , 17098746 , 17116689 , 17139261 , 17159902 , 17268548 , 17290220 , 17297477 , 17301054 , 17302414 , 17310983 , 17318220 , 17347673 , 17363365 , 17369817 , 17380154 , 17426254 , 17438265 , 17470788 , 17525743 , 17591690 , 17616658 , 17666403 , 17848574 , 17875722 , 17908790 , 17936559 , 17989425 , 18061646 , 18172499 , 18223694 , 18234963 , 18309296 , 18316739 , 18332869 , 18467333 , 18485870 , 18541670 , 18566590 , 18604177 , 18665269 , 18813780 , 18815136 , 18981217 , 19033382 , 19071110 , 19081178 , 19085961 , 19098711 , 19106616 , 19153082 , 19160491 , 19166840 , 19188367 , 19223463 , 19234109 , 19255450 , 19303885 , 19305137 , 19332559 , 19357310 , 19411066 , 19411846 , 19483087 , 19568783 , 19590512 , 19597489 , 19656744 , 19805293 , 19816404 , 19837670 , 19857530 , 19941302 , 20047188 , 20080206 , 20124408 , 20173098 , 20174603 , 20234175 , 20235143 , 20395212 , 20479273 , 20484049 , 20542919 , 20570896 , 20588255 , 20591429 , 20591651 , 20639885 , 20657550 , 20659896 , 20660730 , 20694676 , 20705607 , 20708156 , 20837658 , 20847049 , 20959462 , 20962272 , 21060154 , 21071676 , 21075307 , 21084285 , 21084564 , 21088494 , 21098709 , 21132010 , 21149449 , 21170087 , 21261729 , 21268072 , 21316347 , 21317885 , 21454483 , 21465263 , 21471462 , 21478269 , 21561866 , 21572037 , 21584881 , 21726810 , 21750659 , 21857681 , 21887275 , 21925390 , 21965653 , 21986495 , 21988832 , 22032989 , 22083959 , 22084066 , 22085928 , 22103682 , 22124327 , 22157679 , 22227409 , 22262183 , 22266850 , 22266868 , 22301280 , 22318540 , 22331460 , 22366412 , 22374672 , 22389628 , 22391559 , 22411991 , 22444248 , 22474335 , 22487680 , 22510990 , 22525275 , 22575647 , 22588298 , 22653443 , 22659184 , 22737255 , 22807444 , 22819825 , 22912717 , 22914926 , 22916255 , 22920093 , 22948151 , 22975381 , 23134341 , 23150668 , 23169665 , 23201157 , 23246961 , 23252402 , 23261415 , 23318437 , 23370271 , 23402884 , 23443559 , 23483203 , 23572512 , 23609977 , 23671280 , 23728348 , 23776060 , 23776465 , 23802716 , 23826318 , 23880345 , 23946421 , 24127580 , 24200963 , 24207125 , 24240685 , 24314634 , 24361594 , 24413661 , 24462112 , 24488098 , 24567357 , 24621507 , 24643130 , 24659749 , 24667498 , 24842904 , 24926618 , 24980433 , 24998844 , 25103245 , 25156994 , 25168242 , 25241761 , 25277184 , 25283148 , 25312347 , 25313037 , 25362358 , 25384516 , 25417702 , 25464845 , 25512388 , 25543083 , 25609649 , 25624478 , 25637791 , 25739118 , 25954860 , 26001071 , 26186194 , 26203195 , 26238070 , 26350565 , 26475964 , 26540344 , 26556313 , 26578655 , 26673821 , 26720344 , 26876197 , 26882543 , 26883110 , 26908445 , 27031960 , 27106262 , 27129163 , 27215386 , 27282385 , 27308622 , 27336364 , 27462439 , 27543608 , 27807478 , 27811966 , 27856536 , 27886165 , 27893708 , 28082682 , 28223335 , 28362432 , 28394340 , 28514442 , 28542145 , 28549433 , 28553961 , 28605833 , 7686617 , 7689721 , 8058315 , 8875929 , 9131587 , 9223638 , 9271120 , 9278461 , 9363941 , 9450543 , 9529249 , 9582019 , 9724739 , 9809062 , 9824166 , (Europe PMC )0.99 BioGRID, IntAct, MINT TP53I3 Affinity Capture-Western, Reconstituted Complex physical 28605833 , (Europe PMC )NA BioGRID TP53RK Biochemical Activity physical 24124579 , (Europe PMC )NA BioGRID TP63 Affinity Capture-Western, Reconstituted Complex physical 11714701 , 20571051 , 21088494 , 25417702 , (Europe PMC )NA BioGRID TP73 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, classical fluorescence spectroscopy, nuclear magnetic resonance direct interaction, physical 10207051 , 10435614 , 10469568 , 18499675 , 19218448 , 20588255 , 21088494 , 21261729 , 25301064 , 25417702 , 26025930 , (Europe PMC )0.56 BioGRID, IntAct TPR Protein-peptide physical 24583282 , (Europe PMC )NA BioGRID TPT1 Affinity Capture-Western, Reconstituted Complex physical 22912717 , (Europe PMC )NA BioGRID TRAF5 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TRIM13 Affinity Capture-Western, Biochemical Activity physical 21333377 , (Europe PMC )NA BioGRID TRIM23 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRIM27 Affinity Capture-Western, Biochemical Activity physical 20972456 , (Europe PMC )NA BioGRID TRIM28 Affinity Capture-MS, Affinity Capture-Western physical 16107876 , 17056014 , 20858735 , (Europe PMC )NA BioGRID TRIM4 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TRIM9 Two-hybrid, two hybrid array physical, physical association 22493164 , (Europe PMC )0.37 BioGRID, IntAct TSC22D3 Affinity Capture-Western, Co-localization physical 25168242 , (Europe PMC )NA BioGRID TSG101 Affinity Capture-Western physical 11172000 , 17060450 , (Europe PMC )NA BioGRID TSNAX display technology physical association 20195357 , (Europe PMC )0.40 IntAct TSPYL6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TTF1 Affinity Capture-Western, Reconstituted Complex physical 22383580 , (Europe PMC )NA BioGRID TUBA1C Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17373842 , (Europe PMC )0.35 BioGRID, IntAct TUBB Affinity Capture-MS, display technology physical, physical association 17373842 , 20195357 , (Europe PMC )0.40 BioGRID, IntAct TUBB1 anti bait coimmunoprecipitation association 17373842 , (Europe PMC )0.35 IntAct TUBB2A Affinity Capture-MS physical 17373842 , (Europe PMC )NA BioGRID U2AF2 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID UBB anti tag coimmunoprecipitation physical association 17936559 , (Europe PMC )0.40 IntAct UBC Biochemical Activity, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, pull down association, physical, physical association 16023600 , 17170710 , 17290220 , 18566590 , 19098711 , 19166840 , 24143256 , (Europe PMC )0.82 BioGRID, IntAct, MINT UBE2A Affinity Capture-Western physical 12640129 , 22083959 , (Europe PMC )NA BioGRID UBE2B Affinity Capture-Western physical 22083959 , (Europe PMC )NA BioGRID UBE2D1 Reconstituted Complex, Two-hybrid physical 12646252 , 12690203 , 14671306 , 15001357 , 15013777 , 15242646 , 15280377 , 17170710 , 17301054 , 17848574 , 18632619 , 19032150 , 19240029 , 19247369 , 19597489 , 19805293 , 19965871 , 20124408 , 20173098 , 20694676 , 21157430 , 21887275 , 22124327 , 22331460 , 22916255 , 23150668 , 23671280 , 24980433 , 25543083 , 25624478 , 25888903 , 27106262 , 27903893 , 28362432 , 9450543 , (Europe PMC )NA BioGRID UBE2D2 Biochemical Activity, Reconstituted Complex, molecular sieving direct interaction, physical 10562557 , 10722742 , 11713287 , 11724934 , 14517261 , 14769800 , 15280377 , 15950904 , 16338390 , 17159902 , 17349959 , 18451149 , 18632619 , 18665269 , 19219073 , 19372219 , 19619542 , 19816404 , 20705607 , 20874444 , 21084285 , 21965653 , 22157679 , 22301280 , 22902369 , 22989009 , 23871895 , 24127580 , 24567357 , 24980433 , 26025930 , 28553961 , (Europe PMC )0.44 BioGRID, IntAct UBE2D3 Reconstituted Complex physical 11486026 , 15280377 , 15546622 , 19656744 , 19683495 , 20453884 , 20484049 , 21060154 , 21572037 , 21965653 , 22032989 , 24167073 , 24842904 , 24980433 , 28605833 , (Europe PMC )NA BioGRID UBE2E2 Reconstituted Complex physical 21965653 , 24980433 , (Europe PMC )NA BioGRID UBE2E3 Reconstituted Complex physical 21965653 , 24980433 , (Europe PMC )NA BioGRID UBE2G2 Two-hybrid, two hybrid array physical, physical association 19690564 , (Europe PMC )0.37 BioGRID, IntAct UBE2I Affinity Capture-Western, Biochemical Activity, Protein-peptide, Reconstituted Complex physical 11384992 , (Europe PMC )NA BioGRID UBE2K Reconstituted Complex, Two-hybrid physical 15280377 , 21965653 , 23933584 , (Europe PMC )NA BioGRID UBE2L3 Reconstituted Complex physical 16714300 , 24980433 , (Europe PMC )NA BioGRID UBE2M Affinity Capture-Western, Reconstituted Complex physical 15242646 , 25624478 , (Europe PMC )NA BioGRID UBE2N Reconstituted Complex physical 21965653 , (Europe PMC )NA BioGRID UBE2U Two-hybrid, two hybrid array physical, physical association 19690564 , (Europe PMC )0.37 BioGRID, IntAct UBE2Z Two-hybrid, two hybrid array physical, physical association 19690564 , (Europe PMC )0.37 BioGRID, IntAct UBE3A Biochemical Activity physical 11486026 , (Europe PMC )NA BioGRID UBE4B Affinity Capture-Western, Co-fractionation, Reconstituted Complex physical 21317885 , 24587254 , (Europe PMC )NA BioGRID UBTF Biochemical Activity, Protein-peptide physical 24124579 , 24583282 , (Europe PMC )NA BioGRID UCHL1 Affinity Capture-Western physical 20395212 , (Europe PMC )NA BioGRID UIMC1 Affinity Capture-Western physical 19433585 , (Europe PMC )NA BioGRID USO1 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID USP10 Affinity Capture-Western physical 20096447 , (Europe PMC )NA BioGRID USP15 Reconstituted Complex physical 27893708 , (Europe PMC )NA BioGRID USP2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, pull down physical, physical association 17290220 , (Europe PMC )0.40 BioGRID, IntAct, MINT USP26 Affinity Capture-Western physical 27810359 , (Europe PMC )NA BioGRID USP42 Affinity Capture-Western physical 22085928 , (Europe PMC )NA BioGRID USP48 Affinity Capture-Western physical 28233861 , (Europe PMC )NA BioGRID USP7 Affinity Capture-Western, Co-crystal Structure, Co-fractionation, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, classical fluorescence spectroscopy, isothermal titration calorimetry, molecular sieving, pull down, x-ray crystallography association, direct interaction, physical, physical association 15916963 , 16402859 , 16474402 , 16845383 , 16943424 , 17380154 , 17936559 , 18566590 , 20713061 , 20816748 , 22056774 , 24462112 , 26238070 , 26460617 , 26971997 , 27452404 , 28196907 , (Europe PMC )0.96 BioGRID, IntAct, MINT VCP Affinity Capture-MS physical 23383273 , 24147044 , (Europe PMC )NA BioGRID VDR Affinity Capture-Western physical 25969952 , (Europe PMC )NA BioGRID VEGFA Affinity Capture-RNA, Protein-RNA physical 28274247 , (Europe PMC )NA BioGRID WDR45 display technology physical association 20195357 , (Europe PMC )0.40 IntAct WT1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct WWOX Affinity Capture-Western physical 16219768 , 25447306 , (Europe PMC )NA BioGRID XAGE1A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID XIAP Affinity Capture-Western, Protein-peptide, Reconstituted Complex physical 19411066 , 23749209 , 25888903 , (Europe PMC )NA BioGRID XPC Affinity Capture-Western, Reconstituted Complex physical 24258024 , (Europe PMC )NA BioGRID XPO1 Affinity Capture-RNA physical 24798327 , (Europe PMC )NA BioGRID XRCC6 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex physical 19247369 , 24147044 , (Europe PMC )NA BioGRID YAF2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID YWHAQ Affinity Capture-Western, Reconstituted Complex physical 16943424 , 20086099 , (Europe PMC )NA BioGRID YY1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 15210108 , 22659184 , (Europe PMC )0.40 BioGRID, IntAct, MINT YY1AP1 Two-hybrid physical 21988832 , (Europe PMC )NA BioGRID YY1AP1 two hybrid physical association 21988832 , (Europe PMC )0.37 IntAct ZBTB1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct ZNF133 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct ZNF274 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF318 Affinity Capture-MS physical 24147044 , (Europe PMC )NA BioGRID ZNF326 display technology physical association 20195357 , (Europe PMC )0.40 IntAct ZNF420 Affinity Capture-Western, Reconstituted Complex physical 25691462 , (Europe PMC )NA BioGRID ZNF550 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF668 Affinity Capture-Western physical 21852383 , (Europe PMC )NA BioGRID ZNF764 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF766 display technology physical association 20195357 , (Europe PMC )0.40 IntAct ZNHIT6 display technology physical association 20195357 , (Europe PMC )0.40 IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
ABL1 Y276_SDEDDEVyQVTVYQA , Y394_QSQESEDySQPSTSS , Y400_DYSQPSTySSIIYSS , Y405_STSSSIIySSQEDVK , in vitro, in vivo 12110584 ,(Europe PMC )HPRD, PhosphoSitePlus , AKT1 S166_SSRRRAIsETEENSD , S172_ISETEENsDELSGER , S186_RQRKRHKsDSISLSF , S188_RKRHKSDsISLSFDE , S192_KSDSISLsFDESLAL , in vitro, in vivo 11504915 , 15527798 , 19664995 ,(Europe PMC )HPRD, PhosphoSitePlus , ATM S386_DDKITQAsQSQESED , S395_SQESEDYsQPSTSSS , S401_YSQPSTSsSIIYSSQ , S429_KEESVESsLPLNAIE , LTP, in vitro, in vivo 11331603 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , ATR S407_SSSIIYSsQEDVKEF , LTP 14654783 ,(Europe PMC )PhosphoELM , PhosphoSitePlus , Abl Y394_QSQESEDySQPSTSS , LTP 12110584 , 14757045 , 16702947 ,(Europe PMC )PhosphoELM , CSNK1D S118_NQQESSDsGTSVSEN , S121_ESSDSGTsVSENRCH , S166_SSRRRAIsETEENSD , S172_ISETEENsDELSGER , S176_EENSDELsGERQRKR , S220_SESTGTPsNPDLDAG , S229_PDLDAGVsEHSGDWL , S240_GDWLDQDsVSDQFSV , S253_SVEFEVEsLDSEDYS , S260_SLDSEDYsLSEEGQE , S262_DSEDYSLsEEGQELS , S269_SEEGQELsDEDDEVY , S290_AGESDTDsFEEDPEI , S342_GKDKGEIsEKAKLEN , S350_EKAKLENsTQAEEGF , S373_IVNDSREsCVEENDD , S386_DDKITQAsQSQESED , T279_DDEVYQVtVYQAGES , T351_KAKLENStQAEEGFD , T365_DVPDCKKtIVNDSRE , T419_KEFEREEtQDKEESV , NA NA PhosphoSitePlus , CSNK2A1 S260_SLDSEDYsLSEEGQE , S269_SEEGQELsDEDDEVY , NA NA PhosphoSitePlus , DAPK3 S166_SSRRRAIsETEENSD , S186_RQRKRHKsDSISLSF , LTP 15001356 ,(Europe PMC )PhosphoELM , PhosphoSitePlus , MAPKAPK2 S157_SHLVSRPsTSSRRRA , S166_SSRRRAIsETEENSD , NA NA PhosphoSitePlus , PAK6 S186_RQRKRHKsDSISLSF , T158_HLVSRPStSSRRRAI , NA NA PhosphoSitePlus , PIM1 S166_SSRRRAIsETEENSD , S186_RQRKRHKsDSISLSF , NA NA PhosphoSitePlus , PKB_group S166_SSRRRAIsETEENSD , S186_RQRKRHKsDSISLSF , S188_RKRHKSDsISLSFDE , LTP 11504915 , 15169778 , 15527798 ,(Europe PMC )PhosphoELM , PKM S166_SSRRRAIsETEENSD , T351_KAKLENStQAEEGFD , NA NA PhosphoSitePlus , PLK1 S260_SLDSEDYsLSEEGQE , NA NA PhosphoSitePlus , SRC Y281_EVYQVTVyQAGESDT , Y302_PEISLADyWKCTSCN , NA NA PhosphoSitePlus , Unknown S157_SHLVSRPsTSSRRRA , S166_SSRRRAIsETEENSD , S240_GDWLDQDsVSDQFSV , S242_WLDQDSVsDQFSVEF , S246_DSVSDQFsVEFEVES , S260_SLDSEDYsLSEEGQE , S262_DSEDYSLsEEGQELS , S269_SEEGQELsDEDDEVY , LTP, in vitro, in vivo 12167711 , 15527798 , 15688025 , 15703839 ,(Europe PMC )HPRD, PhosphoELM ,