Top
KRT8
Localization (UniProt annotation) Cytoplasm Nucleus, nucleoplasm Nucleus matrix Function (UniProt annotation) Together with KRT19, helps to link the contractileapparatus to dystrophin at the costameres of striated muscle Catalytic Activity (UniProt annotation) N/A Protein Sequence MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEV
DPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLK
LEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQIS
DTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAE
IEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEES
RLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDV
LPK
KRT8 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-6805567 Keratinization. Keratins are the major structural protein of vertebrate epidermis, constituting up to 85% of a fully differentiated keratinocyte (Fuchs 1995). Keratins belong to a superfamily of intermediate filament (IF) proteins that form alpha-helical coiled-coil dimers, which associate laterally and end-to-end to form approximately 10 nm diameter filaments. Keratin filaments are heteropolymeric, formed from equal amounts of acidic type I and basic /neutral type 2 keratins. Humans have 54 keratin genes (Schweitzer et al. 2006). They have highly specific expression patterns, related to the epithelial type and stage of differentiation. Roughly half of human keratins are specific to hair follicles (Langbein & Schweizer 2005). Keratin filaments bundle into tonofilaments that span the cytoplasm and bind to desmosomes and other cell membrane structures (Waschke 2008). This reflects their primary function, maintaining the mechanical stability of individual cells and epithelial tissues (Moll et al. 2008) R-HSA-6809371 Formation of the cornified envelope. As keratinocytes progress towards the upper epidermis, they undergo a unique process of cell death termed cornification (Eckhart et al. 2013). This involves the crosslinking of keratinocyte proteins such as loricrin and involucrin by transglutaminases and the breakdown of the nucleus and other organelles by intracellular and secreted proteases (Eckhart et al. 2000, Denecker et al. 2008). This process is strictly regulated by the Ca2+ concentration gradient in the epidermis (Esholtz et al. 2014). Loricrin and involucrin are encoded in ‘Epidermal Differentiation Complex’ linked to a large number of genes encoding nonredundant components of the CE (Kypriotou et al. 2012, Niehues et al. 2016). Keratinocytes produce specialized proteins and lipids which are used to construct the cornified envelope (CE), a heavily crosslinked submembranous layer that confers rigidity to the upper epidermis, allows keratin filaments to attach to any location in the cell membrane (Kirfel et al. 2003) and acts as a water-impermeable barrier. The CE has two functional parts: covalently cross-linked proteins (10 nm thick) that comprise the backbone of the envelope and covalently linked lipids (5 nm thick) that coat the exterior (Eckert et al. 2005). Desmosomal components are crosslinked to the CE to form corneodesmosomes, which bind cornified cells together (Ishida-Yamamoto et al. 2011). Mature terminally differentiated cornified cells consist mostly of keratin filaments covalently attached to the CE embedded in lipid lamellae (Kalinin et al. 2002). The exact composition of the cornified envelope varies between epithelia (Steinert et al. 1998); the relative amino-acid composition of the proteins used may determine differential mechanical properties (Kartasova et al. 1996)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ANXA1 Affinity Capture-MS physical 9459484 , (Europe PMC )NA BioGRID APEX1 Affinity Capture-MS physical 19188445 , (Europe PMC )NA BioGRID ASB12 Affinity Capture-MS physical 24337577 , (Europe PMC )NA BioGRID ATF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22304920 , (Europe PMC )0.35 BioGRID, IntAct BYSL Two-hybrid, three hybrid association, physical 9560222 , (Europe PMC )0.31 BioGRID, IntAct CAV1 Co-fractionation physical 20808760 , (Europe PMC )NA BioGRID CDH1 Affinity Capture-MS physical 16212417 , (Europe PMC )NA BioGRID CLK1 Biochemical Activity physical 26167880 , (Europe PMC )NA BioGRID CLN5 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct CRK Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID EED Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID ESR1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID FAF2 Affinity Capture-MS physical 22119785 , (Europe PMC )NA BioGRID FBXO25 Biochemical Activity physical 23940030 , (Europe PMC )NA BioGRID FGFR3 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct FN1 Affinity Capture-MS physical 19738201 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-MS, Two-hybrid, pull down, two hybrid pooling approach association, physical, physical association 12577067 , 20936779 , (Europe PMC )0.55 BioGRID, IntAct HSPA4L Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HSPA5 Reconstituted Complex physical 9409741 , (Europe PMC )NA BioGRID IKBKG Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, two hybrid physical, physical association 20098747 , 21988832 , (Europe PMC )0.51 BioGRID, IntAct IQCB1 Affinity Capture-MS physical 21565611 , (Europe PMC )NA BioGRID ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KPNA2 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct KRT13 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID KRT15 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct KRT17 Two-hybrid physical 9630597 , (Europe PMC )NA BioGRID KRT18 Two-hybrid, biophysical, confocal microscopy, cosedimentation, cosedimentation in solution, fluorescence microscopy, two hybrid, two hybrid array, two hybrid prey pooling approach colocalization, physical, physical association 10852826 , 10954706 , 11684708 , 14756564 , 21988832 , 9630597 , (Europe PMC )0.90 BioGRID, IntAct KRT31 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct KRT38 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct KRT40 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct MAPK1 Biochemical Activity physical 11788583 , (Europe PMC )NA BioGRID MAPK14 Biochemical Activity, Reconstituted Complex physical 11788583 , (Europe PMC )NA BioGRID MAPK8 Affinity Capture-Western physical 11781324 , (Europe PMC )NA BioGRID NOS2 Affinity Capture-MS physical 23438482 , (Europe PMC )NA BioGRID OTUD4 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct PAN2 Affinity Capture-MS physical 23398456 , (Europe PMC )NA BioGRID PKP1 Reconstituted Complex, far western blotting, surface plasmon resonance association, physical, physical association 10852826 , (Europe PMC )0.50 BioGRID, IntAct PLAT Reconstituted Complex physical 9988531 , (Europe PMC )NA BioGRID PNN Reconstituted Complex, Two-hybrid physical 10809736 , (Europe PMC )NA BioGRID PPEF2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PPL Reconstituted Complex, Two-hybrid, fluorescence microscopy colocalization, physical 12366696 , 22841549 , (Europe PMC )0.27 BioGRID, IntAct, MINT PPP6C Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PRKCE Affinity Capture-Western physical 1374067 , (Europe PMC )NA BioGRID QRSL1 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID RCHY1 Affinity Capture-Western, Reconstituted Complex physical 19282868 , (Europe PMC )NA BioGRID STAM2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TADA2A Affinity Capture-MS physical 20508642 , (Europe PMC )NA BioGRID TES Affinity Capture-MS physical 28378594 , (Europe PMC )NA BioGRID TFIP11 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct TJP1 Affinity Capture-MS, pull down association, physical 16944923 , (Europe PMC )0.35 BioGRID, IntAct TRAF6 Affinity Capture-Western physical 27586056 , (Europe PMC )NA BioGRID TROAP Reconstituted Complex, pull down, three hybrid association, physical 9560222 , (Europe PMC )0.45 BioGRID, IntAct UBASH3B Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID USP32 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct WBP2 Reconstituted Complex physical 27578003 , (Europe PMC )NA BioGRID YWHAQ Affinity Capture-MS physical 20618440 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ATF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22304920 , (Europe PMC )0.35 BioGRID, IntAct BYSL Two-hybrid, three hybrid association, physical 9560222 , (Europe PMC )0.31 BioGRID, IntAct CFTR anti bait coimmunoprecipitation, confocal microscopy, proximity ligation assay, surface plasmon resonance association, colocalization, direct interaction, physical association 22038833 , (Europe PMC )0.61 IntAct CLN5 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct DMD far western blotting association 16000376 , (Europe PMC )0.35 IntAct DNAJB6 cosedimentation physical association 10954706 , (Europe PMC )0.40 IntAct EBI-1059102 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1059111 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1059276 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct FGFR3 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct GRB2 Affinity Capture-MS, Two-hybrid, pull down, two hybrid pooling approach association, physical, physical association 12577067 , 20936779 , (Europe PMC )0.55 BioGRID, IntAct HSPA4L Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct IKBKG Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, two hybrid physical, physical association 20098747 , 21988832 , (Europe PMC )0.51 BioGRID, IntAct KPNA2 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct KRT15 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct KRT18 Two-hybrid, biophysical, confocal microscopy, cosedimentation, cosedimentation in solution, fluorescence microscopy, two hybrid, two hybrid array, two hybrid prey pooling approach colocalization, physical, physical association 10852826 , 10954706 , 11684708 , 14756564 , 21988832 , 9630597 , (Europe PMC )0.90 BioGRID, IntAct KRT31 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct KRT38 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct KRT40 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct LILRB3 affinity chromatography technology, confocal microscopy association 26769854 , (Europe PMC )0.43 IntAct OTUD4 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct PASK peptide array phosphorylation reaction 21418524 , (Europe PMC )0.44 IntAct, MINT PKP1 Reconstituted Complex, far western blotting, surface plasmon resonance association, physical, physical association 10852826 , (Europe PMC )0.50 BioGRID, IntAct PKP2 far western blotting physical association 10852826 , (Europe PMC )0.40 IntAct PPL Reconstituted Complex, Two-hybrid, fluorescence microscopy colocalization, physical 12366696 , 22841549 , (Europe PMC )0.27 BioGRID, IntAct, MINT QRSL1 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT RAF1 experimental interaction detection association 15314064 , (Europe PMC )0.22 IntAct, MINT TFIP11 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct TJP1 Affinity Capture-MS, pull down association, physical 16944923 , (Europe PMC )0.35 BioGRID, IntAct TROAP Reconstituted Complex, pull down, three hybrid association, physical 9560222 , (Europe PMC )0.45 BioGRID, IntAct USP32 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct VIM anti bait coimmunoprecipitation association 15846844 , (Europe PMC )0.35 IntAct YBX1 anti tag coimmunoprecipitation physical association 23986595 , (Europe PMC )0.40 IntAct YWHAZ tandem affinity purification association 20618440 , (Europe PMC )0.35 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source PASK peptide array phosphorylation reaction 21418524 , (Europe PMC )0.44 IntAct, MINT PPL Reconstituted Complex, Two-hybrid, fluorescence microscopy colocalization, physical 12366696 , 22841549 , (Europe PMC )0.27 BioGRID, IntAct, MINT QRSL1 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT RAF1 experimental interaction detection association 15314064 , (Europe PMC )0.22 IntAct, MINT YWHAZ tandem affinity purification association 20618440 , (Europe PMC )0.35 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ANXA1 Affinity Capture-MS physical 9459484 , (Europe PMC )NA BioGRID APEX1 Affinity Capture-MS physical 19188445 , (Europe PMC )NA BioGRID ASB12 Affinity Capture-MS physical 24337577 , (Europe PMC )NA BioGRID ATF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22304920 , (Europe PMC )0.35 BioGRID, IntAct BYSL Two-hybrid, three hybrid association, physical 9560222 , (Europe PMC )0.31 BioGRID, IntAct CAV1 Co-fractionation physical 20808760 , (Europe PMC )NA BioGRID CDH1 Affinity Capture-MS physical 16212417 , (Europe PMC )NA BioGRID CFTR anti bait coimmunoprecipitation, confocal microscopy, proximity ligation assay, surface plasmon resonance association, colocalization, direct interaction, physical association 22038833 , (Europe PMC )0.61 IntAct CLK1 Biochemical Activity physical 26167880 , (Europe PMC )NA BioGRID CLN5 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct CRK Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID DMD far western blotting association 16000376 , (Europe PMC )0.35 IntAct DNAJB6 cosedimentation physical association 10954706 , (Europe PMC )0.40 IntAct EBI-1059102 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1059111 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EBI-1059276 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EED Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID ESR1 Reconstituted Complex physical 20348541 , (Europe PMC )NA BioGRID FAF2 Affinity Capture-MS physical 22119785 , (Europe PMC )NA BioGRID FBXO25 Biochemical Activity physical 23940030 , (Europe PMC )NA BioGRID FGFR3 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct FN1 Affinity Capture-MS physical 19738201 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-MS, Two-hybrid, pull down, two hybrid pooling approach association, physical, physical association 12577067 , 20936779 , (Europe PMC )0.55 BioGRID, IntAct HSPA4L Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct HSPA5 Reconstituted Complex physical 9409741 , (Europe PMC )NA BioGRID IKBKG Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti tag coimmunoprecipitation, two hybrid physical, physical association 20098747 , 21988832 , (Europe PMC )0.51 BioGRID, IntAct IQCB1 Affinity Capture-MS physical 21565611 , (Europe PMC )NA BioGRID ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KPNA2 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct KRT13 Two-hybrid physical 25416956 , (Europe PMC )NA BioGRID KRT15 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct KRT17 Two-hybrid physical 9630597 , (Europe PMC )NA BioGRID KRT18 Two-hybrid, biophysical, confocal microscopy, cosedimentation, cosedimentation in solution, fluorescence microscopy, two hybrid, two hybrid array, two hybrid prey pooling approach colocalization, physical, physical association 10852826 , 10954706 , 11684708 , 14756564 , 21988832 , 9630597 , (Europe PMC )0.90 BioGRID, IntAct KRT31 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct KRT38 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct KRT40 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.70 BioGRID, IntAct LILRB3 affinity chromatography technology, confocal microscopy association 26769854 , (Europe PMC )0.43 IntAct MAPK1 Biochemical Activity physical 11788583 , (Europe PMC )NA BioGRID MAPK14 Biochemical Activity, Reconstituted Complex physical 11788583 , (Europe PMC )NA BioGRID MAPK8 Affinity Capture-Western physical 11781324 , (Europe PMC )NA BioGRID NOS2 Affinity Capture-MS physical 23438482 , (Europe PMC )NA BioGRID OTUD4 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct PAN2 Affinity Capture-MS physical 23398456 , (Europe PMC )NA BioGRID PASK peptide array phosphorylation reaction 21418524 , (Europe PMC )0.44 IntAct, MINT PKP1 Reconstituted Complex, far western blotting, surface plasmon resonance association, physical, physical association 10852826 , (Europe PMC )0.50 BioGRID, IntAct PKP2 far western blotting physical association 10852826 , (Europe PMC )0.40 IntAct PLAT Reconstituted Complex physical 9988531 , (Europe PMC )NA BioGRID PNN Reconstituted Complex, Two-hybrid physical 10809736 , (Europe PMC )NA BioGRID PPEF2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PPL Reconstituted Complex, Two-hybrid, fluorescence microscopy colocalization, physical 12366696 , 22841549 , (Europe PMC )0.27 BioGRID, IntAct, MINT PPP6C Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PRKCE Affinity Capture-Western physical 1374067 , (Europe PMC )NA BioGRID QRSL1 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID QRSL1 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT RAF1 experimental interaction detection association 15314064 , (Europe PMC )0.22 IntAct, MINT RCHY1 Affinity Capture-Western, Reconstituted Complex physical 19282868 , (Europe PMC )NA BioGRID STAM2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TADA2A Affinity Capture-MS physical 20508642 , (Europe PMC )NA BioGRID TES Affinity Capture-MS physical 28378594 , (Europe PMC )NA BioGRID TFIP11 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct TJP1 Affinity Capture-MS, pull down association, physical 16944923 , (Europe PMC )0.35 BioGRID, IntAct TRAF6 Affinity Capture-Western physical 27586056 , (Europe PMC )NA BioGRID TROAP Reconstituted Complex, pull down, three hybrid association, physical 9560222 , (Europe PMC )0.45 BioGRID, IntAct UBASH3B Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID USP32 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct VIM anti bait coimmunoprecipitation association 15846844 , (Europe PMC )0.35 IntAct WBP2 Reconstituted Complex physical 27578003 , (Europe PMC )NA BioGRID YBX1 anti tag coimmunoprecipitation physical association 23986595 , (Europe PMC )0.40 IntAct YWHAQ Affinity Capture-MS physical 20618440 , (Europe PMC )NA BioGRID YWHAZ tandem affinity purification association 20618440 , (Europe PMC )0.35 IntAct, MINT
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
AURKB T6_MSIRVtQKSYKVS , NA NA PhosphoSitePlus , CDK1 S432_SAYGGLTsPGLSYSL , LTP 9054461 , 9524113 ,(Europe PMC )PhosphoELM , PhosphoSitePlus , MAP2K1 S74_TVNQSLLsPLVLEVD , NA NA PhosphoSitePlus , MAP2K2 S74_TVNQSLLsPLVLEVD , NA NA PhosphoSitePlus , MAPK1 S432_SAYGGLTsPGLSYSL , S74_TVNQSLLsPLVLEVD , in vitro, in vivo 11781324 , 11788583 , 18691976 , 19007248 , 9211903 ,(Europe PMC )HPRD, PhosphoSitePlus , MAPK14 S74_TVNQSLLsPLVLEVD , LTP, in vitro, in vivo 11781324 , 11788583 , 18691976 , 19007248 , 9211903 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , MAPK3 S432_SAYGGLTsPGLSYSL , S74_TVNQSLLsPLVLEVD , LTP, in vitro, in vivo 11781324 , 11788583 , 18669648 , 18691976 , 19007248 , 9054461 , 9211903 , 9524113 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , MAPK8 S432_SAYGGLTsPGLSYSL , S74_TVNQSLLsPLVLEVD , LTP, in vitro, in vivo 11781324 , 11788583 , 18691976 , 19007248 , 9211903 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , PKC_delta S74_TVNQSLLsPLVLEVD , LTP 15972820 ,(Europe PMC )PhosphoELM , PRKCD S74_TVNQSLLsPLVLEVD , NA NA PhosphoSitePlus , Unknown S104_TLNNKFAsFIDKVRF , S13_TQKSYKVsTSGPRAF , S21_TSGPRAFsSRSYTSG , S22_SGPRAFSsRSYTSGP , S240_RELQSQIsDTSVVLS , S243_QSQISDTsVVLSMDN , S24_PRAFSSRsYTSGPGS , S251_VVLSMDNsRSLDMDS , S253_LSMDNSRsLDMDSII , S258_SRSLDMDsIIAEVKA , S274_YEDIANRsRAEAESM , S27_FSSRSYTsGPGSRIS , S315_SEMNRNIsRLQAEIE , S330_GLKGQRAsLEAAIAD , S34_SGPGSRIsSSSFSRV , S35_GPGSRISsSSFSRVG , S36_PGSRISSsSFSRVGS , S37_GSRISSSsFSRVGSS , S39_RISSSSFsRVGSSNF , S400_KLLEGEEsRLESGMQ , S410_ESGMQNMsIHTKTTS , S424_SGYAGGLsSAYGGLT , S432_SAYGGLTsPGLSYSL , S436_GLTSPGLsYSLGSSF , S438_TSPGLSYsLGSSFGS , S43_SSFSRVGsSNFRGGL , S441_GLSYSLGsSFGSGAG , S442_LSYSLGSsFGSGAGS , S445_SLGSSFGsGAGSSSF , S44_SFSRVGSsNFRGGLG , S451_GSGAGSSsFSRTSSS , S456_SSSFSRTsSSRAVVV , S475_TRDGKLVsESSDVLP , S477_DGKLVSEsSDVLPK , S478_GKLVSESsDVLPK , S9_SIRVTQKsYKVSTSG , T14_QKSYKVStSGPRAFS , T26_AFSSRSYtSGPGSRI , T431_SSAYGGLtSPGLSYS , Y204_KKDVDEAyMNKVELE , Y228_INFLRQLyEEEIREL , Y25_RAFSSRSyTSGPGSR , Y267_IAEVKAQyEDIANRS , Y427_AGGLSSAyGGLTSPG , Y437_LTSPGLSySLGSSFG , HTP, LTP, in vitro, in vivo 16083285 , 16565220 , 16964243 , 17081983 , 17924679 , 18083107 , 18212344 , 18452278 , 18669648 , 18691976 , 18767875 , 19007248 , 19415658 , 19651622 , 19664994 , 19664995 , 20068230 , 20068231 , 20166139 , 9054461 ,(Europe PMC )HPRD, PhosphoELM ,