Top
ICK
Localization (UniProt annotation) Nucleus Cytoplasm, cytosol Cell projection, cilium Cytoplasm, cytoskeleton, ciliumbasal body Note=Also found at theciliary tip (PubMed:24797473) Nuclear localization has beenobserved with a GFP-tagged construct in transfected HeLa cells(PubMed:12103360, PubMed:19185282) Isoform 2: Cytoplasm Note=Predominant cytoplasmiclocalization has been observed with a N-terminally GFP-taggedconstruct Function (UniProt annotation) Required for ciliogenesis (PubMed:24797473)Phosphorylates KIF3A (By similarity) Involved in the control ofciliary length (PubMed:24853502) Regulates the ciliarylocalization of SHH pathway components as well as the localizationof IFT components at ciliary tips (By similarity) May play a keyrole in the development of multiple organ systems and particularlyin cardiac development (By similarity) Regulates intraflagellartransport (IFT) speed and negatively regulates cilium length in acAMP and mTORC1 signaling-dependent manner and this regulationrequires its kinase activity (By similarity) Catalytic Activity (UniProt annotation) ATP + a protein = ADP + a phosphoprotein Protein Sequence MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFE
YMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYV
STRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQ
CVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQALRYPYFQVGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPV
PPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPK
SRRRWGLISRSTKDSDDWADLDDLDFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPT
LRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSSSTSSSGLTGNYVPSFL
KKEIGSAMQRVHLAPIPDPSPGYSSLKAMRPHPGRPFFHTQPRSTPGLIPRPPAAQPVHGRTDWASKYASRR
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
ICK is dephosphorylated by following phosphatases:
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source A4GALT Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID A4GNT Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID APP Reconstituted Complex physical 21244100 , 21832049 , (Europe PMC )NA BioGRID BAG6 Biochemical Activity, Reconstituted Complex physical 16954377 , (Europe PMC )NA BioGRID BLM Synthetic Growth Defect genetic 24104479 , (Europe PMC )NA BioGRID BMP7 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CD247 Affinity Capture-Western physical 8626561 , (Europe PMC )NA BioGRID CDC7 Affinity Capture-Western physical 16954377 , (Europe PMC )NA BioGRID CDK1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CDK14 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CDK16 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CDK20 Affinity Capture-Western, Biochemical Activity physical 16954377 , (Europe PMC )NA BioGRID CENPL Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CKS1B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CLUAP1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CPSF1 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct DEPDC1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FAM217B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FCGR3B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID HSP90AA1 Affinity Capture-Luminescence, Affinity Capture-Western physical 22939624 , (Europe PMC )NA BioGRID IFT172 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct IFT88 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct IL1R1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID KIAA0556 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , (Europe PMC )0.51 BioGRID, IntAct LINC01667 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LSM14B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MAK Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAPK1 Affinity Capture-Western physical 16954377 , 8626561 , (Europe PMC )NA BioGRID MNAT1 Affinity Capture-Western physical 16954377 , (Europe PMC )NA BioGRID MSI2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID NR0B2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID NUP188 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct PSMC6 Affinity Capture-MS physical 23602568 , (Europe PMC )NA BioGRID PSMD1 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct RPTOR Biochemical Activity, Co-fractionation physical 22356909 , (Europe PMC )NA BioGRID SLC35A1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SMAD1 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMYD2 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification physical, physical association 27173435 , (Europe PMC )0.53 BioGRID, IntAct TP53 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct VCP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CLUAP1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CPSF1 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct HSP90AB1 anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.52 IntAct IFT172 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct IFT88 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct KIAA0556 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , (Europe PMC )0.51 BioGRID, IntAct MAK Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MCM7 anti bait coimmunoprecipitation association 23764002 , (Europe PMC )0.35 IntAct NUP188 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct PPP2CB tandem affinity purification association 23602568 , (Europe PMC )0.35 IntAct PSMD1 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct SMAD1 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMYD2 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification physical, physical association 27173435 , (Europe PMC )0.53 BioGRID, IntAct TP53 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source A4GALT Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID A4GNT Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID APP Reconstituted Complex physical 21244100 , 21832049 , (Europe PMC )NA BioGRID BAG6 Biochemical Activity, Reconstituted Complex physical 16954377 , (Europe PMC )NA BioGRID BLM Synthetic Growth Defect genetic 24104479 , (Europe PMC )NA BioGRID BMP7 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CD247 Affinity Capture-Western physical 8626561 , (Europe PMC )NA BioGRID CDC7 Affinity Capture-Western physical 16954377 , (Europe PMC )NA BioGRID CDK1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CDK14 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CDK16 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CDK20 Affinity Capture-Western, Biochemical Activity physical 16954377 , (Europe PMC )NA BioGRID CENPL Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CKS1B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CLUAP1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct CPSF1 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct DEPDC1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FAM217B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FCGR3B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID HSP90AA1 Affinity Capture-Luminescence, Affinity Capture-Western physical 22939624 , (Europe PMC )NA BioGRID HSP90AB1 anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.52 IntAct IFT172 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct IFT88 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct IL1R1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID KIAA0556 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , (Europe PMC )0.51 BioGRID, IntAct LINC01667 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LSM14B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MAK Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , (Europe PMC )0.27 BioGRID, IntAct MAPK1 Affinity Capture-Western physical 16954377 , 8626561 , (Europe PMC )NA BioGRID MCM7 anti bait coimmunoprecipitation association 23764002 , (Europe PMC )0.35 IntAct MNAT1 Affinity Capture-Western physical 16954377 , (Europe PMC )NA BioGRID MSI2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID NR0B2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID NUP188 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct PPP2CB tandem affinity purification association 23602568 , (Europe PMC )0.35 IntAct PSMC6 Affinity Capture-MS physical 23602568 , (Europe PMC )NA BioGRID PSMD1 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct RPTOR Biochemical Activity, Co-fractionation physical 22356909 , (Europe PMC )NA BioGRID SLC35A1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SMAD1 Two-hybrid, two hybrid physical, physical association 15231748 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMYD2 Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification physical, physical association 27173435 , (Europe PMC )0.53 BioGRID, IntAct TP53 Affinity Capture-MS, tandem affinity purification association, physical 23602568 , (Europe PMC )0.35 BioGRID, IntAct VCP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
CDK20 T157_IRSKPPYtDYVSTRW , NA NA PhosphoSitePlus , CDK7 T157_IRSKPPYtDYVSTRW , LTP 15988018 ,(Europe PMC )PhosphoELM , ICK Y159_SKPPYTDyVSTRWYR , LTP 15988018 ,(Europe PMC )PhosphoELM , Unknown S254_KTLIPNAsSEAVQLL , T157_IRSKPPYtDYVSTRW , Y156_EIRSKPPyTDYVSTR , Y159_SKPPYTDyVSTRWYR , HTP, in vitro, in vivo 10699974 , 18083107 , 18691976 , 20068231 ,(Europe PMC )HPRD, PhosphoELM ,