Top
HSPB1
Localization (UniProt annotation) Cytoplasm Nucleus Cytoplasm, cytoskeleton, spindle Note=Cytoplasmic in interphasecells Colocalizes with mitotic spindles in mitotic cellsTranslocates to the nucleus during heat shock and resides in sub-nuclear structures known as SC35 speckles or nuclear splicingspeckles Function (UniProt annotation) Small heat shock protein which functions as a molecularchaperone probably maintaining denatured proteins in a folding-competent state (PubMed:10383393, PubMed:20178975) Plays a rolein stress resistance and actin organization (PubMed:19166925)Through its molecular chaperone activity may regulate numerousbiological processes including the phosphorylation and the axonaltransport of neurofilament proteins (PubMed:23728742) Catalytic Activity (UniProt annotation) N/A Protein Sequence MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQ
LSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPE
GTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
HSPB1 is dephosphorylated by following phosphatases:
Pathway ID Pathway Name Pathway Description (KEGG) hsa04010 MAPK signaling pathway The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli. hsa04370 VEGF signaling pathway There is now much evidence that VEGFR-2 is the major mediator of VEGF-driven responses in endothelial cells and it is considered to be a crucial signal transducer in both physiologic and pathologic angiogenesis. The binding of VEGF to VEGFR-2 leads to a cascade of different signaling pathways, resulting in the up-regulation of genes involved in mediating the proliferation and migration of endothelial cells and promoting their survival and vascular permeability. For example, the binding of VEGF to VEGFR-2 leads to dimerization of the receptor, followed by intracellular activation of the PLCgamma;PKC-Raf kinase-MEK-mitogen-activated protein kinase (MAPK) pathway and subsequent initiation of DNA synthesis and cell growth, whereas activation of the phosphatidylinositol 3' -kinase (PI3K)-Akt pathway leads to increased endothelial-cell survival. Activation of PI3K, FAK, and p38 MAPK is implicated in cell migration signaling. hsa05146 Amoebiasis Entamoeba histolytica, an extracellular protozoan parasite is a human pathogen that invades the intestinal epithelium. Infection occurs on ingestion of contaminated water and food. The pathogenesis of amoebiasis begins with parasite attachment and disruption of the intestinal mucus layer, followed by apoptosis of host epithelial cells. Intestinal tissue destruction causes severe dysentery and ulcerations in amoebic colitis. Several amoebic proteins such as lectins, cysteine proteineases, and amoebapores are associated with the invasion process. The parasite can cause extraintestinal infection like amoebic liver abscess by evading immune response.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-4420097 VEGFA-VEGFR2 Pathway. Angiogenesis is the formation of new blood vessels from preexisting vasculature. One of the most important proangiogenic factors is vascular endothelial growth factor (VEGF). VEGF exerts its biologic effect through interaction with transmembrane tyrosine kinase receptors VEGFR, selectively expressed on vascular endothelial cells. VEGFA signaling through VEGFR2 is the major pathway that activates angiogenesis by inducing the proliferation, survival, sprouting and migration of endothelial cells (ECs), and also by increasing endothelial permeability (Lohela et al. 2009, Shibuya & Claesson-Welsh 2006, Claesson-Welsh & Welsh, 2013). The critical role of VEGFR2 in vascular development is highlighted by the fact that VEGFR2-/- mice die at E8.5-9.5 due to defective development of blood islands, endothelial cells and haematopoietic cells (Shalaby et al. 1995) R-HSA-450408 AUF1 (hnRNP D0) binds and destabilizes mRNA. AUF1 (hnRNP D0) dimers bind U-rich regions of AU-rich elements (AREs) in the 3' untranslated regions of mRNAs. The binding causes AUF1 dimers to assemble into higher order tetrameric complexes. Diphosphorylated AUF1 bound to RNA recruits additional proteins, including eIF4G, polyA-binding protein, Hsp, Hsc70, Hsp27, NSEP-1, NSAP-1, and IMP-2 which target the mRNA and AUF1 for degradation. Unphosphorylated AUF1 is thought to be less able to recruit additional proteins. AUF1 also interacts directly or indirectly with HuR and the RNA-induced silencing complex (RISC).AUF1 complexed with RNA and other proteins is ubiquitinated and targeted for destruction by the proteasome while the bound mRNA is degraded. Inhibition of ubiquitin addition to AUF1 blocks mRNA degradation. The mechanism by which ubiquitin-dependent proteolysis is coupled to mRNA degradation is unknown.At least 4 isoforms of AUF1 exist: p45 (45 kDa) contains all exons, p42 lacks exon 2, p40 lacks exon 7, and p37 lacks exons 2 and 7. The presence of exon 7 in p42 and p45 seems to block ubiquitination while the absence of exon 7 (p37 and p40) targets AUF1 for ubiquitination and destabilizes bound RNAs. Lack of exon 2 (p37 and p42) is associated with higher affinity for RNA and 14-3-3sigma (SFN).AUF1 binds and destabilizes mRNAs encoding Interleukin-1 beta (IL1B), Tumor Necrosis Factor alpha (TNFA), Cyclin-dependent kinase inhibitor 1 (CDNK1A, p21), Cyclin-D1 (CCND1), Granulocyte-macrophage colony stimulating factor (GM-CSF, CSF2), inducible Nitric oxide synthase (iNOS, NOS2), Proto-oncogene cFos (FOS), Myc proto-oncogene (MYC), Apoptosis regulator Bcl-2 (BCL2) R-HSA-5687128 MAPK6/MAPK4 signaling. MAPK6 and MAPK4 (also known as ERK3 and ERK4) are vertebrate-specific atypical MAP kinases. Atypical MAPK are less well characterized than their conventional counterparts, and are generally classified as such based on their lack of activation by MAPKK family members. Unlike the conventional MAPK proteins, which contain a Thr-X-Tyr motif in the activation loop, MAPK6 and 4 have a single Ser-Glu-Gly phospho-acceptor motif (reviewed in Coulombe and Meloche, 2007; Cargnello et al, 2011). MAPK6 is also distinct in being an unstable kinase, whose turnover is mediated by ubiquitin-dependent degradation (Coulombe et al, 2003; Coulombe et al, 2004). The biological functions and pathways governing MAPK6 and 4 are not well established. MAPK6 and 4 are phosphorylated downstream of class I p21 activated kinases (PAKs) in a RAC- or CDC42-dependent manner (Deleris et al, 2008; Perander et al, 2008; Deleris et al, 2011; De La Mota-Peynado et al, 2011). One of the only well established substrates of MAPK6 and 4 is MAPKAPK5, which contributes to cell motility by promoting the HSBP1-dependent rearrangement of F-actin (Gerits et al, 2007; Kostenko et al, 2009a; reviewed in Kostenko et al, 2011b). The atypical MAPKs also contribute to cell motility and invasiveness through the NCOA3:ETV4-dependent regulation of MMP gene expression (Long et al, 2012; Yan et al, 2008; Qin et al, 2008)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AARSD1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct AATK Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct ACAP2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ACBD6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ACTN1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ACTN2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ACTN4 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID ADCY9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ADD3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ADPRHL2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AGAP10P Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID AGAP3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AGAP4 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID AGAP5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AGAP7P Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AHCY Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID AHNAK Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID AKT1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, proximity ligation assay physical, physical association 11042204 , 12740362 , 17510053 , 23397142 , (Europe PMC )0.40 BioGRID, IntAct ALPI Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AMD1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ANAPC7 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ANK1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ANKRD7 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ANXA1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AP2B1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ARAF Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct ARHGAP28 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ARHGDIA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ARHGEF7 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ARIH1 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID ARMC6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARMT1 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID ARRDC5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ASB10 Affinity Capture-MS physical 24337577 , (Europe PMC )NA BioGRID ASB17 Affinity Capture-MS physical 24337577 , (Europe PMC )NA BioGRID ASB4 Affinity Capture-MS physical 24337577 , (Europe PMC )NA BioGRID ASB6 Affinity Capture-MS physical 24337577 , (Europe PMC )NA BioGRID ATF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22304920 , (Europe PMC )0.35 BioGRID, IntAct ATIC Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATXN10 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct BAG3 Affinity Capture-Luminescence, Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, reverse ras recruitment system association, physical, physical association 25036637 , 25277244 , 26496610 , (Europe PMC )0.72 BioGRID, IntAct BICDL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct BRCA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID BTRC Affinity Capture-MS physical 25900982 , (Europe PMC )NA BioGRID BUB1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct BVES Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID C11orf98 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID C12orf10 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct C2orf73 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CALR Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct CAMK1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CARHSP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CASP3 Affinity Capture-Western physical 22238643 , (Europe PMC )NA BioGRID CBX1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCDC32 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID CCDC70 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCHCR1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCNC Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCND2 Affinity Capture-MS physical 27371349 , (Europe PMC )NA BioGRID CCNDBP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCNO Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CDC123 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CDC5L Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT CDC73 Affinity Capture-MS physical 27462432 , (Europe PMC )NA BioGRID CDK1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CDK5RAP3 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID CENPK Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CEP57 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID CEP78 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CETN3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CFTR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 17110338 , 23155000 , 26618866 , 26627832 , (Europe PMC )0.35 BioGRID, IntAct CHUK Affinity Capture-Western physical 16840786 , (Europe PMC )NA BioGRID CLCN3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct COPS5 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CPSF3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CRK Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID CRNKL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CRYAA Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down direct interaction, physical, physical association 11700327 , 12601044 , (Europe PMC )0.61 BioGRID, IntAct, MINT CRYAB Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, nuclear magnetic resonance, pull down, two hybrid direct interaction, physical, physical association 11700327 , 12601044 , 1560006 , 17916631 , 18330356 , 20863832 , 23188086 , 23532854 , 26186194 , 28514442 , (Europe PMC )0.79 BioGRID, IntAct, MINT CRYBB2 Affinity Capture-Western, Two-hybrid, pull down direct interaction, physical 11700327 , (Europe PMC )0.44 BioGRID, IntAct, MINT CRYGC Two-hybrid physical 12601044 , (Europe PMC )NA BioGRID CS Reconstituted Complex physical 10383393 , (Europe PMC )NA BioGRID CSRP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CYCS Affinity Capture-Western physical 11784858 , (Europe PMC )NA BioGRID CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID DAXX Affinity Capture-Western, Co-localization, proximity ligation assay, pull down, two hybrid physical, physical association 11003656 , 25241761 , (Europe PMC )0.65 BioGRID, IntAct, MINT DES Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct DFFA Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct DLST Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DMAP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct DMWD Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct DNAJC21 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct DUSP16 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID DUT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ECPAS Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID EDEM3 Affinity Capture-MS physical 28366632 , (Europe PMC )NA BioGRID EEF1A1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EEF1B2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EEF1D Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EFTUD2 Affinity Capture-Luminescence, Two-hybrid, anti tag coimmunoprecipitation, two hybrid physical, physical association 22365833 , (Europe PMC )0.51 BioGRID, IntAct, MINT EGFR Affinity Capture-MS, anti bait coimmunoprecipitation, proximity ligation assay, tandem affinity purification association, physical, physical association 15657067 , 23397142 , 24189400 , (Europe PMC )0.67 BioGRID, IntAct EHD1 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID EIF1AX Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EIF2S1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EIF3M Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID EIF4A2 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct EIF4B Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EIF4G2 Affinity Capture-Western, Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID EIF4G3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EIF5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ENPP2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EPB41L1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EPB41L2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EPB41L3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ERCC5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ERICH6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ERP29 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ESR1 Affinity Capture-MS, Reconstituted Complex physical 20348541 , 23576398 , (Europe PMC )NA BioGRID EZH2 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID FAM71D Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct FKBP4 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct FLNB Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct FN1 Affinity Capture-MS physical 19738201 , (Europe PMC )NA BioGRID FTH1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct FXR1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct G6PD Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation physical, physical association 21157431 , 26344197 , (Europe PMC )0.40 BioGRID, IntAct, MINT GAPVD1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GARS Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GATA1 Affinity Capture-Western, Two-hybrid physical 20410505 , (Europe PMC )NA BioGRID GDI2 Co-fractionation, Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , 26344197 , (Europe PMC )0.37 BioGRID, IntAct GLMN Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GLO1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GLOD4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GMPS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GNPAT Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GOLGA8A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GRIPAP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GRK3 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID GRPEL1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GSTO1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct GTSF1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GUCA1A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HAUS1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID HAUS8 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HDAC6 Affinity Capture-Western physical 22238643 , (Europe PMC )NA BioGRID HDLBP Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HECTD1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HMGN5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HNRNPA1 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID HNRNPA2B1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HNRNPD Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, FRET physical 18573886 , 21245386 , 23530064 , (Europe PMC )NA BioGRID HNRNPF Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HNRNPH1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HNRNPH2 Co-fractionation, Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , 26344197 , (Europe PMC )0.37 BioGRID, IntAct HNRNPH3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HNRNPU Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID HSF1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western physical 19597476 , 25036637 , (Europe PMC )NA BioGRID HSP90AA1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HSP90AB1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HSPA4 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HSPA5 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID HSPA8 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPA9 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPB1 Reconstituted Complex, Two-hybrid, luminescence based mammalian interactome mapping, pull down, reverse ras recruitment system, two hybrid physical, physical association 10383393 , 11003656 , 22365833 , 25036637 , 25277244 , (Europe PMC )0.77 BioGRID, IntAct, MINT HSPB6 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HSPB8 Affinity Capture-Western, Two-hybrid, fluorescent resonance energy transfer, two hybrid physical, physical association 14594798 , 15122253 , (Europe PMC )0.51 BioGRID, IntAct HUWE1 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25147182 , 25277244 , (Europe PMC )0.51 BioGRID, IntAct HYPK Affinity Capture-MS physical 23272104 , (Europe PMC )NA BioGRID IARS2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct IGBP1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct IGSF21 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct IKBKB Affinity Capture-Western physical 16840786 , (Europe PMC )NA BioGRID ILK Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 17353931 , 25852190 , (Europe PMC )0.56 BioGRID, IntAct INPP5K Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID INS Reconstituted Complex physical 10383393 , (Europe PMC )NA BioGRID IPO7 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID IQCB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21565611 , (Europe PMC )0.35 BioGRID, IntAct IRAK1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct IRS4 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct ISG15 Affinity Capture-Western physical 16815975 , (Europe PMC )NA BioGRID ISG20L2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID ITPA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID JPT1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID JPT2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID KANSL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KCMF1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KCTD3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KLC1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KNSTRN Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID KPNA3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KRT18 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KRT72 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct LASP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID LBP Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct LCE3A Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 25036637 , (Europe PMC )0.40 BioGRID, IntAct LIG1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct LIMK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct LONRF1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct LRIF1 Two-hybrid physical 16169070 , (Europe PMC )NA BioGRID LSM3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct LUZP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MAGED1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MAP3K7 Affinity Capture-Western physical 24686082 , (Europe PMC )NA BioGRID MAPK14 Biochemical Activity physical 10908726 , (Europe PMC )NA BioGRID MAPKAPK2 Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, protein kinase assay, proximity ligation assay phosphorylation reaction, physical, physical association 10383393 , 10978313 , 11042204 , 11839738 , 11844797 , 12740362 , 12829704 , 14499342 , 14688255 , 15850461 , 17170118 , 18326031 , 21131586 , 21575178 , 25241761 , 26616734 , 8774846 , 8995385 , (Europe PMC )0.61 BioGRID, IntAct MAPKAPK3 Biochemical Activity, Co-localization, protein kinase assay, proximity ligation assay phosphorylation reaction, physical, physical association 21575178 , 25241761 , 8774846 , (Europe PMC )0.61 BioGRID, IntAct MAPKAPK5 Affinity Capture-Western, Biochemical Activity, protein kinase assay phosphorylation reaction, physical 10978313 , 19166925 , 21575178 , 9628874 , (Europe PMC )0.44 BioGRID, IntAct MCM2 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MCM6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MED31 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct MFAP1 Two-hybrid physical 22365833 , (Europe PMC )NA BioGRID MME Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy association, colocalization, physical, physical association 17342744 , (Europe PMC )0.54 BioGRID, IntAct MPHOSPH6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MRGBP Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MRPL28 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MRPL40 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MRPS23 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MSL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MSN Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MTIF2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MYC Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct MYL12A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MYL12B Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MYL9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MYLK Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NAMPT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NAP1L1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NAPA Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NBAS Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NCKIPSD Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NEK10 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NEXN Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID NFU1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NOS2 Affinity Capture-MS physical 23438482 , (Europe PMC )NA BioGRID NPM1 Affinity Capture-MS physical 23402259 , (Europe PMC )NA BioGRID NRDC Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID NSMCE4A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NVL Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct OBSL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct OLA1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID OPTN Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct OSBPL9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct OXCT1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PAF1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct PAICS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PALLD Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PALM3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PCSK9 Affinity Capture-MS physical 23085658 , (Europe PMC )NA BioGRID PDHA1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct PDLIM1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PELO Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PEX19 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PFDN2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PGM2 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct PHF12 Affinity Capture-MS physical 26841866 , (Europe PMC )NA BioGRID PHLDA1 Affinity Capture-Western physical 17024176 , (Europe PMC )NA BioGRID PHYHIPL Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PITPNA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PITPNB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PKM Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PLG Far Western, Reconstituted Complex physical 17206383 , (Europe PMC )NA BioGRID PNISR Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PNPT1 Co-fractionation, Two-hybrid, reverse ras recruitment system physical, physical association 22939629 , 25277244 , (Europe PMC )0.37 BioGRID, IntAct PPA1 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PPM1A Two-hybrid, reverse ras recruitment system, two hybrid array physical, physical association 21988832 , 25277244 , (Europe PMC )0.55 BioGRID, IntAct PPP2R3C Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PRDX6 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PRKCD Affinity Capture-Western physical 15731106 , (Europe PMC )NA BioGRID PRKD1 Biochemical Activity, Reconstituted Complex physical 15728188 , (Europe PMC )NA BioGRID PRPF19 Two-hybrid physical 22365833 , (Europe PMC )NA BioGRID PRPF40A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSAT1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PSMA3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMA6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMB2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMC1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMD1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PTBP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PTGES3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PTPN22 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PTPN3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PTPRA Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PUM1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RAB41 Affinity Capture-Western, Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID RAD23A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RALA Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RASSF9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RBM25 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RBM39 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RBM48 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct RBPJ Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RBX1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RNF114 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RPA1 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA2 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA3 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPAP3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RPSA Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID RSPH3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RYBP Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct S100A4 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SARS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SAT1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SBF1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SDHA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SEC13 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SEPHS1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SERTAD1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SF3A3 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct SF3B3 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT SIK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct SLC7A9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SMARCA2 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID SMARCA4 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SMARCD1 Two-hybrid physical 21988832 , (Europe PMC )NA BioGRID SMN1 Affinity Capture-Western physical 17916631 , (Europe PMC )NA BioGRID SMURF2 Affinity Capture-Western physical 21967197 , (Europe PMC )NA BioGRID SNCA Affinity Capture-MS, Reconstituted Complex physical 19651786 , 21905118 , (Europe PMC )NA BioGRID SNRNP200 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SNRPF Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SNW1 Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system association, physical, physical association 20467437 , 25277244 , (Europe PMC )0.55 BioGRID, IntAct, MINT SOX2 Affinity Capture-MS physical 23667531 , (Europe PMC )NA BioGRID SPACA7 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID SPATA7 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SPIN1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct SPTBN1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SQSTM1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SRMS Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 25852190 , (Europe PMC )0.40 BioGRID, IntAct SRP72 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SRRM2 Affinity Capture-MS physical 16159877 , (Europe PMC )NA BioGRID STAT2 Affinity Capture-Western physical 22238643 , (Europe PMC )NA BioGRID STIP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STMN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STRN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STUB1 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID SUPT5H Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SYCE1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TARBP2 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID TARDBP Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TARS Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TBC1D1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TBC1D3B Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TCPT Affinity Capture-Western physical 25277244 , (Europe PMC )NA BioGRID TES Affinity Capture-MS, Co-fractionation physical 26344197 , 28378594 , (Europe PMC )NA BioGRID TGFB1I1 Affinity Capture-Western, Two-hybrid physical 11546764 , 24831009 , (Europe PMC )NA BioGRID THOC5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TJP2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TKT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TMCO3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TNF Affinity Capture-RNA physical 21245386 , (Europe PMC )NA BioGRID TOMM70 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID TOX4 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TP53 Affinity Capture-Western, Co-localization, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay, two hybrid pooling approach physical, physical association 16169070 , 17184779 , 25241761 , (Europe PMC )0.69 BioGRID, IntAct, MINT TPM3 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TPT1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct TRIM24 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TRIM25 Affinity Capture-MS physical 29117863 , (Europe PMC )NA BioGRID TRIM54 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TSNAXIP1 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID TTC3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TTC39C Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TUBA1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TUBA4A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TXNL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TYK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct UAP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UBA2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UBC Affinity Capture-MS physical 16196087 , (Europe PMC )NA BioGRID UBE2I Affinity Capture-Western physical 19597476 , 23155000 , (Europe PMC )NA BioGRID UBE2N Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UBL4A Affinity Capture-MS physical 23246001 , (Europe PMC )NA BioGRID UCHL5 Reconstituted Complex physical 21800051 , (Europe PMC )NA BioGRID UFD1 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID UGDH Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UNG Affinity Capture-Western, Reconstituted Complex physical 10629618 , (Europe PMC )NA BioGRID UQCC2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct UQCRB Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct USP1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct USP14 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID USP38 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct VCP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID VIM Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct WASHC3 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID WDR66 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID WDR83 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT WWOX Affinity Capture-MS physical 24550385 , (Europe PMC )NA BioGRID WWP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct XPO1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct XRCC5 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct YAP1 Affinity Capture-MS physical 25796446 , (Europe PMC )NA BioGRID YWHAB Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct YWHAE Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct YWHAH Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct YWHAQ Affinity Capture-MS, Two-hybrid, reverse ras recruitment system physical, physical association 20618440 , 25277244 , (Europe PMC )0.37 BioGRID, IntAct YWHAZ Two-hybrid, pull down, reverse ras recruitment system, tandem affinity purification association, physical, physical association 15161933 , 20618440 , 25277244 , (Europe PMC )0.68 BioGRID, IntAct, MINT ZBTB1 Affinity Capture-MS physical 24657165 , (Europe PMC )NA BioGRID ZBTB17 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZBTB37 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZFAT Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZNF131 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZNF197 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZNRF3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZYX Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AARSD1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct AATK Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct ACAP2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ACBD6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ACTN1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ACTN2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ACTN4 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct ADCY9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ADD3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ADPRHL2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AGAP3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AGAP4 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct AGAP5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AGAP7P Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AGAP9 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct AKT1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, proximity ligation assay physical, physical association 11042204 , 12740362 , 17510053 , 23397142 , (Europe PMC )0.40 BioGRID, IntAct ALPI Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AMD1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ANAPC7 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ANG anti bait coimmunoprecipitation association 28777577 , (Europe PMC )0.35 IntAct, MINT ANK1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ANKRD7 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ANXA1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AP2B1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct APPL1 two hybrid fragment pooling approach physical association 23414517 , (Europe PMC )0.37 IntAct ARAF Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct ARHGAP28 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ARHGEF7 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ARIH1 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct ARMC6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARMT1 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct ARRDC5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ATF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22304920 , (Europe PMC )0.35 BioGRID, IntAct ATXN10 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct BAG3 Affinity Capture-Luminescence, Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, reverse ras recruitment system association, physical, physical association 25036637 , 25277244 , 26496610 , (Europe PMC )0.72 BioGRID, IntAct BICDL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct BRF2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct BUB1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct BVES reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct C12orf10 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct C2orf73 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CALR Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct CAMK1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CBX1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCDC32 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct CCDC70 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCHCR1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCNC Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCNDBP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCNO Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CDC123 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CDC5L Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT CDK5RAP3 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct CENPK Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CEP78 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CETN3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CFTR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 17110338 , 23155000 , 26618866 , 26627832 , (Europe PMC )0.35 BioGRID, IntAct CIAO1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CLCN3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CPSF3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CRNKL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CRYAA Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down direct interaction, physical, physical association 11700327 , 12601044 , (Europe PMC )0.61 BioGRID, IntAct, MINT CRYAB Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, nuclear magnetic resonance, pull down, two hybrid direct interaction, physical, physical association 11700327 , 12601044 , 1560006 , 17916631 , 18330356 , 20863832 , 23188086 , 23532854 , 26186194 , 28514442 , (Europe PMC )0.79 BioGRID, IntAct, MINT CRYBB2 Affinity Capture-Western, Two-hybrid, pull down direct interaction, physical 11700327 , (Europe PMC )0.44 BioGRID, IntAct, MINT CT55 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct DAXX Affinity Capture-Western, Co-localization, proximity ligation assay, pull down, two hybrid physical, physical association 11003656 , 25241761 , (Europe PMC )0.65 BioGRID, IntAct, MINT DES Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct DFFA Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct DLST Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DMAP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct DMWD Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct DNAJC21 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct E2F6 tandem affinity purification association 27705803 , (Europe PMC )0.35 IntAct ECPAS reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct EFTUD2 Affinity Capture-Luminescence, Two-hybrid, anti tag coimmunoprecipitation, two hybrid physical, physical association 22365833 , (Europe PMC )0.51 BioGRID, IntAct, MINT EGFR Affinity Capture-MS, anti bait coimmunoprecipitation, proximity ligation assay, tandem affinity purification association, physical, physical association 15657067 , 23397142 , 24189400 , (Europe PMC )0.67 BioGRID, IntAct EHD1 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct EIF1AX Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EIF2S1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EIF3M reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct EIF4A2 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct EIF4G1 filter binding direct interaction 10859165 , (Europe PMC )0.44 IntAct, MINT EIF4G2 anti bait coimmunoprecipitation, reverse ras recruitment system physical association 25277244 , (Europe PMC )0.51 IntAct EIF4G3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EIF5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ENPP2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EPB41L1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EPB41L2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EPB41L3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ERCC5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ERICH6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct F13A1 proximity ligation assay physical association 23397142 , (Europe PMC )0.40 IntAct FAM71D Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct FKBP4 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct FLNB Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct FTH1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct FXR1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct G6PD Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation physical, physical association 21157431 , 26344197 , (Europe PMC )0.40 BioGRID, IntAct, MINT GABARAPL1 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GABARAPL2 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GAPVD1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GARS Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GDI2 Co-fractionation, Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , 26344197 , (Europe PMC )0.37 BioGRID, IntAct GET4 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct GLMN Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GNPAT Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GOLGA8A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GRB2 pull down association 12577067 , (Europe PMC )0.35 IntAct GRIPAP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GRK3 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct GSTO1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct GTSF1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GUCA1A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HAUS8 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HDLBP Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HECTD1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HINFP reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct HNRNPA2B1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HNRNPF Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HNRNPH2 Co-fractionation, Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , 26344197 , (Europe PMC )0.37 BioGRID, IntAct HNRNPU reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct HSF1 anti tag coimmunoprecipitation association 25036637 , (Europe PMC )0.35 IntAct HSP90AA1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HSP90AB1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HSPA4 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HSPA5 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct HSPB1 Reconstituted Complex, Two-hybrid, luminescence based mammalian interactome mapping, pull down, reverse ras recruitment system, two hybrid physical, physical association 10383393 , 11003656 , 22365833 , 25036637 , 25277244 , (Europe PMC )0.77 BioGRID, IntAct, MINT HSPB8 Affinity Capture-Western, Two-hybrid, fluorescent resonance energy transfer, two hybrid physical, physical association 14594798 , 15122253 , (Europe PMC )0.51 BioGRID, IntAct HUWE1 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25147182 , 25277244 , (Europe PMC )0.51 BioGRID, IntAct IARS2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct IGBP1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct IGSF21 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct ILK Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 17353931 , 25852190 , (Europe PMC )0.56 BioGRID, IntAct INPP5K reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct IQCB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21565611 , (Europe PMC )0.35 BioGRID, IntAct IRAK1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct IRS4 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct ISG20L2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KANSL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KCMF1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KCTD3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KLC1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KNSTRN reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct KPNA3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KRT18 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KRT72 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KSR1 anti tag coimmunoprecipitation association 27086506 , (Europe PMC )0.35 IntAct LBHD1 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct LBP Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct LCE3A Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 25036637 , (Europe PMC )0.40 BioGRID, IntAct LIG1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct LIMK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct LONRF1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct LRRK2 tandem affinity purification association 24725412 , (Europe PMC )0.35 IntAct LSM3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct LUZP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MAGEA6 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct MAGED1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MAP1LC3A anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct MAP1LC3B anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct MAPK6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MAPKAPK2 Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, protein kinase assay, proximity ligation assay phosphorylation reaction, physical, physical association 10383393 , 10978313 , 11042204 , 11839738 , 11844797 , 12740362 , 12829704 , 14499342 , 14688255 , 15850461 , 17170118 , 18326031 , 21131586 , 21575178 , 25241761 , 26616734 , 8774846 , 8995385 , (Europe PMC )0.61 BioGRID, IntAct MAPKAPK3 Biochemical Activity, Co-localization, protein kinase assay, proximity ligation assay phosphorylation reaction, physical, physical association 21575178 , 25241761 , 8774846 , (Europe PMC )0.61 BioGRID, IntAct MAPKAPK5 Affinity Capture-Western, Biochemical Activity, protein kinase assay phosphorylation reaction, physical 10978313 , 19166925 , 21575178 , 9628874 , (Europe PMC )0.44 BioGRID, IntAct MCM6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MED31 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct MFAP1 two hybrid physical association 22365833 , (Europe PMC )0.37 IntAct, MINT MME Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy association, colocalization, physical, physical association 17342744 , (Europe PMC )0.54 BioGRID, IntAct MPHOSPH6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MRGBP Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MRPL28 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MRPL40 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MRPS23 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MSL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MTIF2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MYC Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct MYL12A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MYL12B Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MYL9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MYLK Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NAP1L1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NAPA Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NBAS Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NBEAL2 tandem affinity purification association 29187380 , (Europe PMC )0.35 IntAct NCKIPSD Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NEK10 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NEXN reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct NFU1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NSMCE4A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NVL Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct OBSL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct OPTN Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct OSBPL9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PAF1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct PALM3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PASK peptide array phosphorylation reaction 21418524 , (Europe PMC )0.44 IntAct, MINT PCGF5 tandem affinity purification association 27705803 , (Europe PMC )0.35 IntAct PDHA1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct PELO Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PGM2 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct PHYHIPL Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PNISR Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PNPT1 Co-fractionation, Two-hybrid, reverse ras recruitment system physical, physical association 22939629 , 25277244 , (Europe PMC )0.37 BioGRID, IntAct PPA1 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PPM1A Two-hybrid, reverse ras recruitment system, two hybrid array physical, physical association 21988832 , 25277244 , (Europe PMC )0.55 BioGRID, IntAct PPP2R3C Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PRPF19 two hybrid physical association 22365833 , (Europe PMC )0.37 IntAct, MINT PRPF40A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMA3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMA6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMB2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMC1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMD1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMD6 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PTBP3 anti bait coimmunoprecipitation association 22575643 , (Europe PMC )0.35 IntAct, MINT PTGES3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PTPN3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PTPRA Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RAB43 anti bait coimmunoprecipitation, reverse ras recruitment system physical association 25277244 , (Europe PMC )0.51 IntAct RAD23A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RALA Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RASSF9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RBM25 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RBM39 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RBM48 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct RBPJ Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RBX1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RIF1 two hybrid pooling approach physical association 16169070 , (Europe PMC )0.37 IntAct RPAP3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RPSA reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct RSPH3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RYBP Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct S100A4 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SAP18 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SAT1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SBF1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SEC13 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SERTAD1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SF3A3 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct SF3B3 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT SIK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct SIM2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct SLC7A9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SLX4 anti tag coimmunoprecipitation association 19596235 , (Europe PMC )0.35 IntAct SMARCA2 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct SMARCA4 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SMARCD1 two hybrid physical association 21988832 , (Europe PMC )0.37 IntAct SNRNP200 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SNRPF Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SNW1 Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system association, physical, physical association 20467437 , 25277244 , (Europe PMC )0.55 BioGRID, IntAct, MINT SPACA7 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct SPATA7 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SPIN1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct SPTBN1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SQSTM1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SRMS Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 25852190 , (Europe PMC )0.40 BioGRID, IntAct SRP72 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct STK4 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct STRN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STUB1 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct SUPT5H Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SYCE1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TARBP2 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct TARS Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TBC1D1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TBC1D3B Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct THOC5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TJP2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TMCO3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TOMM70 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct TOX4 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TP53 Affinity Capture-Western, Co-localization, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay, two hybrid pooling approach physical, physical association 16169070 , 17184779 , 25241761 , (Europe PMC )0.69 BioGRID, IntAct, MINT TPT1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct TRIM24 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TRIM54 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TSC22D1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TSNAXIP1 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct TTC3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TTC39C Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TUBA1A pull down association 27291054 , (Europe PMC )0.35 IntAct TUBA1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TUBB3 pull down association 27291054 , (Europe PMC )0.35 IntAct TXNL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TYK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct UFD1 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct UQCC2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct UQCRB Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct USP1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct USP38 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct VIM Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct WASHC3 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct WDR66 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct WDR83 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT WWP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct XPO1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct XRCC5 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct YWHAB Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct YWHAE Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct YWHAH Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct YWHAQ Affinity Capture-MS, Two-hybrid, reverse ras recruitment system physical, physical association 20618440 , 25277244 , (Europe PMC )0.37 BioGRID, IntAct YWHAZ Two-hybrid, pull down, reverse ras recruitment system, tandem affinity purification association, physical, physical association 15161933 , 20618440 , 25277244 , (Europe PMC )0.68 BioGRID, IntAct, MINT ZBTB17 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZBTB37 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZFAT Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZNF131 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZNF197 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZNRF3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ANG anti bait coimmunoprecipitation association 28777577 , (Europe PMC )0.35 IntAct, MINT CDC5L Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT CRYAA Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down direct interaction, physical, physical association 11700327 , 12601044 , (Europe PMC )0.61 BioGRID, IntAct, MINT CRYAB Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, nuclear magnetic resonance, pull down, two hybrid direct interaction, physical, physical association 11700327 , 12601044 , 1560006 , 17916631 , 18330356 , 20863832 , 23188086 , 23532854 , 26186194 , 28514442 , (Europe PMC )0.79 BioGRID, IntAct, MINT CRYBB2 Affinity Capture-Western, Two-hybrid, pull down direct interaction, physical 11700327 , (Europe PMC )0.44 BioGRID, IntAct, MINT DAXX Affinity Capture-Western, Co-localization, proximity ligation assay, pull down, two hybrid physical, physical association 11003656 , 25241761 , (Europe PMC )0.65 BioGRID, IntAct, MINT EFTUD2 Affinity Capture-Luminescence, Two-hybrid, anti tag coimmunoprecipitation, two hybrid physical, physical association 22365833 , (Europe PMC )0.51 BioGRID, IntAct, MINT EIF4G1 filter binding direct interaction 10859165 , (Europe PMC )0.44 IntAct, MINT G6PD Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation physical, physical association 21157431 , 26344197 , (Europe PMC )0.40 BioGRID, IntAct, MINT HSPB1 Reconstituted Complex, Two-hybrid, luminescence based mammalian interactome mapping, pull down, reverse ras recruitment system, two hybrid physical, physical association 10383393 , 11003656 , 22365833 , 25036637 , 25277244 , (Europe PMC )0.77 BioGRID, IntAct, MINT MFAP1 two hybrid physical association 22365833 , (Europe PMC )0.37 IntAct, MINT PASK peptide array phosphorylation reaction 21418524 , (Europe PMC )0.44 IntAct, MINT PRPF19 two hybrid physical association 22365833 , (Europe PMC )0.37 IntAct, MINT PTBP3 anti bait coimmunoprecipitation association 22575643 , (Europe PMC )0.35 IntAct, MINT SF3B3 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT SNW1 Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system association, physical, physical association 20467437 , 25277244 , (Europe PMC )0.55 BioGRID, IntAct, MINT TP53 Affinity Capture-Western, Co-localization, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay, two hybrid pooling approach physical, physical association 16169070 , 17184779 , 25241761 , (Europe PMC )0.69 BioGRID, IntAct, MINT WDR83 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT YWHAZ Two-hybrid, pull down, reverse ras recruitment system, tandem affinity purification association, physical, physical association 15161933 , 20618440 , 25277244 , (Europe PMC )0.68 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AARSD1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct AATK Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct ACAP2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ACBD6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ACTN1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ACTN2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ACTN4 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID ACTN4 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct ADCY9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ADD3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ADPRHL2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AGAP10P Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID AGAP3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AGAP4 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID AGAP4 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct AGAP5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AGAP7P Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AGAP9 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct AHCY Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID AHNAK Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID AKT1 Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, proximity ligation assay physical, physical association 11042204 , 12740362 , 17510053 , 23397142 , (Europe PMC )0.40 BioGRID, IntAct ALPI Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AMD1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ANAPC7 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ANG anti bait coimmunoprecipitation association 28777577 , (Europe PMC )0.35 IntAct, MINT ANK1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ANKRD7 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ANXA1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct AP2B1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct APPL1 two hybrid fragment pooling approach physical association 23414517 , (Europe PMC )0.37 IntAct ARAF Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct ARHGAP28 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ARHGDIA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ARHGEF7 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ARIH1 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID ARIH1 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct ARMC6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ARMT1 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID ARMT1 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct ARRDC5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ASB10 Affinity Capture-MS physical 24337577 , (Europe PMC )NA BioGRID ASB17 Affinity Capture-MS physical 24337577 , (Europe PMC )NA BioGRID ASB4 Affinity Capture-MS physical 24337577 , (Europe PMC )NA BioGRID ASB6 Affinity Capture-MS physical 24337577 , (Europe PMC )NA BioGRID ATF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22304920 , (Europe PMC )0.35 BioGRID, IntAct ATIC Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ATXN10 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct BAG3 Affinity Capture-Luminescence, Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, reverse ras recruitment system association, physical, physical association 25036637 , 25277244 , 26496610 , (Europe PMC )0.72 BioGRID, IntAct BICDL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct BRCA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID BRF2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct BTRC Affinity Capture-MS physical 25900982 , (Europe PMC )NA BioGRID BUB1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct BVES Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID BVES reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct C11orf98 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID C12orf10 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct C2orf73 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CALR Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct CAMK1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CARHSP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CASP3 Affinity Capture-Western physical 22238643 , (Europe PMC )NA BioGRID CBX1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCDC32 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID CCDC32 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct CCDC70 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCHCR1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCNC Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCND2 Affinity Capture-MS physical 27371349 , (Europe PMC )NA BioGRID CCNDBP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CCNO Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CDC123 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CDC5L Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 20467437 , (Europe PMC )0.35 BioGRID, IntAct, MINT CDC73 Affinity Capture-MS physical 27462432 , (Europe PMC )NA BioGRID CDK1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CDK5RAP3 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID CDK5RAP3 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct CENPK Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CEP57 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID CEP78 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CETN3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CFTR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 17110338 , 23155000 , 26618866 , 26627832 , (Europe PMC )0.35 BioGRID, IntAct CHUK Affinity Capture-Western physical 16840786 , (Europe PMC )NA BioGRID CIAO1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CLCN3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct COPS5 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CPSF3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CRK Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID CRNKL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct CRYAA Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, pull down direct interaction, physical, physical association 11700327 , 12601044 , (Europe PMC )0.61 BioGRID, IntAct, MINT CRYAB Affinity Capture-MS, Affinity Capture-Western, Co-purification, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, nuclear magnetic resonance, pull down, two hybrid direct interaction, physical, physical association 11700327 , 12601044 , 1560006 , 17916631 , 18330356 , 20863832 , 23188086 , 23532854 , 26186194 , 28514442 , (Europe PMC )0.79 BioGRID, IntAct, MINT CRYBB2 Affinity Capture-Western, Two-hybrid, pull down direct interaction, physical 11700327 , (Europe PMC )0.44 BioGRID, IntAct, MINT CRYGC Two-hybrid physical 12601044 , (Europe PMC )NA BioGRID CS Reconstituted Complex physical 10383393 , (Europe PMC )NA BioGRID CSRP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID CT55 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CYCS Affinity Capture-Western physical 11784858 , (Europe PMC )NA BioGRID CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID DAXX Affinity Capture-Western, Co-localization, proximity ligation assay, pull down, two hybrid physical, physical association 11003656 , 25241761 , (Europe PMC )0.65 BioGRID, IntAct, MINT DES Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct DFFA Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct DLST Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DMAP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct DMWD Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct DNAJC21 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct DUSP16 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID DUT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID E2F6 tandem affinity purification association 27705803 , (Europe PMC )0.35 IntAct ECPAS Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID ECPAS reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct EDEM3 Affinity Capture-MS physical 28366632 , (Europe PMC )NA BioGRID EEF1A1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EEF1B2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EEF1D Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EFTUD2 Affinity Capture-Luminescence, Two-hybrid, anti tag coimmunoprecipitation, two hybrid physical, physical association 22365833 , (Europe PMC )0.51 BioGRID, IntAct, MINT EGFR Affinity Capture-MS, anti bait coimmunoprecipitation, proximity ligation assay, tandem affinity purification association, physical, physical association 15657067 , 23397142 , 24189400 , (Europe PMC )0.67 BioGRID, IntAct EHD1 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID EHD1 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct EIF1AX Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EIF2S1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EIF3M Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID EIF3M reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct EIF4A2 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct EIF4B Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID EIF4G1 filter binding direct interaction 10859165 , (Europe PMC )0.44 IntAct, MINT EIF4G2 Affinity Capture-Western, Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID EIF4G2 anti bait coimmunoprecipitation, reverse ras recruitment system physical association 25277244 , (Europe PMC )0.51 IntAct EIF4G3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EIF5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ENPP2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EPB41L1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EPB41L2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct EPB41L3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ERCC5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ERICH6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ERP29 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID ESR1 Affinity Capture-MS, Reconstituted Complex physical 20348541 , 23576398 , (Europe PMC )NA BioGRID EZH2 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID F13A1 proximity ligation assay physical association 23397142 , (Europe PMC )0.40 IntAct FAM71D Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct FKBP4 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct FLNB Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct FN1 Affinity Capture-MS physical 19738201 , (Europe PMC )NA BioGRID FTH1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct FXR1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct G6PD Affinity Capture-Western, Co-fractionation, anti bait coimmunoprecipitation physical, physical association 21157431 , 26344197 , (Europe PMC )0.40 BioGRID, IntAct, MINT GABARAPL1 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GABARAPL2 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GAPVD1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GARS Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GATA1 Affinity Capture-Western, Two-hybrid physical 20410505 , (Europe PMC )NA BioGRID GDI2 Co-fractionation, Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , 26344197 , (Europe PMC )0.37 BioGRID, IntAct GET4 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct GLMN Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GLO1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GLOD4 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GMPS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GNPAT Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GOLGA8A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GRB2 pull down association 12577067 , (Europe PMC )0.35 IntAct GRIPAP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GRK3 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID GRK3 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct GRPEL1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GSTO1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct GTSF1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct GUCA1A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HAUS1 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID HAUS8 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HDAC6 Affinity Capture-Western physical 22238643 , (Europe PMC )NA BioGRID HDLBP Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HECTD1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HINFP reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct HMGN5 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HNRNPA1 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID HNRNPA2B1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HNRNPD Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, FRET physical 18573886 , 21245386 , 23530064 , (Europe PMC )NA BioGRID HNRNPF Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HNRNPH1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HNRNPH2 Co-fractionation, Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , 26344197 , (Europe PMC )0.37 BioGRID, IntAct HNRNPH3 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HNRNPU Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID HNRNPU reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct HSF1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western physical 19597476 , 25036637 , (Europe PMC )NA BioGRID HSF1 anti tag coimmunoprecipitation association 25036637 , (Europe PMC )0.35 IntAct HSP90AA1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HSP90AB1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HSPA4 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct HSPA5 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID HSPA5 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct HSPA8 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPA9 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID HSPB1 Reconstituted Complex, Two-hybrid, luminescence based mammalian interactome mapping, pull down, reverse ras recruitment system, two hybrid physical, physical association 10383393 , 11003656 , 22365833 , 25036637 , 25277244 , (Europe PMC )0.77 BioGRID, IntAct, MINT HSPB6 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HSPB8 Affinity Capture-Western, Two-hybrid, fluorescent resonance energy transfer, two hybrid physical, physical association 14594798 , 15122253 , (Europe PMC )0.51 BioGRID, IntAct HUWE1 Affinity Capture-MS, Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25147182 , 25277244 , (Europe PMC )0.51 BioGRID, IntAct HYPK Affinity Capture-MS physical 23272104 , (Europe PMC )NA BioGRID IARS2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct IGBP1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct IGSF21 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct IKBKB Affinity Capture-Western physical 16840786 , (Europe PMC )NA BioGRID ILK Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation association, physical, physical association 17353931 , 25852190 , (Europe PMC )0.56 BioGRID, IntAct INPP5K Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID INPP5K reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct INS Reconstituted Complex physical 10383393 , (Europe PMC )NA BioGRID IPO7 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID IQCB1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21565611 , (Europe PMC )0.35 BioGRID, IntAct IRAK1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct IRS4 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct ISG15 Affinity Capture-Western physical 16815975 , (Europe PMC )NA BioGRID ISG20L2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ITGA4 Affinity Capture-MS physical 22623428 , (Europe PMC )NA BioGRID ITPA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID JPT1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID JPT2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID KANSL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KCMF1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KCTD3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KLC1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KNSTRN Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID KNSTRN reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct KPNA3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KRT18 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KRT72 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KSR1 anti tag coimmunoprecipitation association 27086506 , (Europe PMC )0.35 IntAct LASP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID LBHD1 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct LBP Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct LCE3A Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 25036637 , (Europe PMC )0.40 BioGRID, IntAct LIG1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct LIMK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct LONRF1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct LRIF1 Two-hybrid physical 16169070 , (Europe PMC )NA BioGRID LRRK2 tandem affinity purification association 24725412 , (Europe PMC )0.35 IntAct LSM3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct LUZP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MAGEA6 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct MAGED1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MAP1LC3A anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct MAP1LC3B anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct MAP3K7 Affinity Capture-Western physical 24686082 , (Europe PMC )NA BioGRID MAPK14 Biochemical Activity physical 10908726 , (Europe PMC )NA BioGRID MAPK6 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct MAPKAPK2 Affinity Capture-Western, Biochemical Activity, Co-localization, Reconstituted Complex, protein kinase assay, proximity ligation assay phosphorylation reaction, physical, physical association 10383393 , 10978313 , 11042204 , 11839738 , 11844797 , 12740362 , 12829704 , 14499342 , 14688255 , 15850461 , 17170118 , 18326031 , 21131586 , 21575178 , 25241761 , 26616734 , 8774846 , 8995385 , (Europe PMC )0.61 BioGRID, IntAct MAPKAPK3 Biochemical Activity, Co-localization, protein kinase assay, proximity ligation assay phosphorylation reaction, physical, physical association 21575178 , 25241761 , 8774846 , (Europe PMC )0.61 BioGRID, IntAct MAPKAPK5 Affinity Capture-Western, Biochemical Activity, protein kinase assay phosphorylation reaction, physical 10978313 , 19166925 , 21575178 , 9628874 , (Europe PMC )0.44 BioGRID, IntAct MCM2 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MCM6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MED31 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct MFAP1 Two-hybrid physical 22365833 , (Europe PMC )NA BioGRID MFAP1 two hybrid physical association 22365833 , (Europe PMC )0.37 IntAct, MINT MME Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, confocal microscopy association, colocalization, physical, physical association 17342744 , (Europe PMC )0.54 BioGRID, IntAct MPHOSPH6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MRGBP Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MRPL28 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MRPL40 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MRPS23 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MSL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MSN Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID MTIF2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MYC Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct MYL12A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MYL12B Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MYL9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct MYLK Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NAMPT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID NAP1L1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NAPA Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NBAS Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NBEAL2 tandem affinity purification association 29187380 , (Europe PMC )0.35 IntAct NCKIPSD Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NEK10 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NEXN Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID NEXN reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct NFU1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NOS2 Affinity Capture-MS physical 23438482 , (Europe PMC )NA BioGRID NPM1 Affinity Capture-MS physical 23402259 , (Europe PMC )NA BioGRID NRDC Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID NSMCE4A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct NTRK1 Affinity Capture-MS physical 25921289 , (Europe PMC )NA BioGRID NVL Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct OBSL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct OLA1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID OPTN Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct OSBPL9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct OXCT1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PAF1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct PAICS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PALLD Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PALM3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PASK peptide array phosphorylation reaction 21418524 , (Europe PMC )0.44 IntAct, MINT PCGF5 tandem affinity purification association 27705803 , (Europe PMC )0.35 IntAct PCSK9 Affinity Capture-MS physical 23085658 , (Europe PMC )NA BioGRID PDHA1 Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct PDLIM1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PELO Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PEX19 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PFDN2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PGM2 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct PHF12 Affinity Capture-MS physical 26841866 , (Europe PMC )NA BioGRID PHLDA1 Affinity Capture-Western physical 17024176 , (Europe PMC )NA BioGRID PHYHIPL Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PITPNA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PITPNB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PKM Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PLG Far Western, Reconstituted Complex physical 17206383 , (Europe PMC )NA BioGRID PNISR Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PNPT1 Co-fractionation, Two-hybrid, reverse ras recruitment system physical, physical association 22939629 , 25277244 , (Europe PMC )0.37 BioGRID, IntAct PPA1 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PPM1A Two-hybrid, reverse ras recruitment system, two hybrid array physical, physical association 21988832 , 25277244 , (Europe PMC )0.55 BioGRID, IntAct PPP2R3C Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PRDX6 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PRKCD Affinity Capture-Western physical 15731106 , (Europe PMC )NA BioGRID PRKD1 Biochemical Activity, Reconstituted Complex physical 15728188 , (Europe PMC )NA BioGRID PRPF19 Two-hybrid physical 22365833 , (Europe PMC )NA BioGRID PRPF19 two hybrid physical association 22365833 , (Europe PMC )0.37 IntAct, MINT PRPF40A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSAT1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PSMA3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMA6 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMB2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMC1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMD1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PSMD6 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PTBP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PTBP3 anti bait coimmunoprecipitation association 22575643 , (Europe PMC )0.35 IntAct, MINT PTGES3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PTPN22 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID PTPN3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PTPRA Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct PUM1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RAB41 Affinity Capture-Western, Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID RAB43 anti bait coimmunoprecipitation, reverse ras recruitment system physical association 25277244 , (Europe PMC )0.51 IntAct RAD23A Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RALA Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RASSF9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RBM25 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RBM39 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RBM48 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct RBPJ Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RBX1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RIF1 two hybrid pooling approach physical association 16169070 , (Europe PMC )0.37 IntAct RNF114 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID RPA1 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA2 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPA3 Affinity Capture-MS physical 24332808 , (Europe PMC )NA BioGRID RPAP3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RPSA Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID RPSA reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct RSPH3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct RYBP Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct S100A4 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SAP18 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SARS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SAT1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SBF1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SDHA Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SEC13 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SEPHS1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID SERTAD1 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct SF3A3 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct SF3B3 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT SIK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct SIM2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct SLC7A9 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SLX4 anti tag coimmunoprecipitation association 19596235 , (Europe PMC )0.35 IntAct SMARCA2 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID SMARCA2 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct SMARCA4 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SMARCD1 Two-hybrid physical 21988832 , (Europe PMC )NA BioGRID SMARCD1 two hybrid physical association 21988832 , (Europe PMC )0.37 IntAct SMN1 Affinity Capture-Western physical 17916631 , (Europe PMC )NA BioGRID SMURF2 Affinity Capture-Western physical 21967197 , (Europe PMC )NA BioGRID SNCA Affinity Capture-MS, Reconstituted Complex physical 19651786 , 21905118 , (Europe PMC )NA BioGRID SNRNP200 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SNRPF Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SNW1 Affinity Capture-MS, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system association, physical, physical association 20467437 , 25277244 , (Europe PMC )0.55 BioGRID, IntAct, MINT SOX2 Affinity Capture-MS physical 23667531 , (Europe PMC )NA BioGRID SPACA7 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID SPACA7 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct SPATA7 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SPIN1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct SPTBN1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SQSTM1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SRMS Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 25852190 , (Europe PMC )0.40 BioGRID, IntAct SRP72 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SRRM2 Affinity Capture-MS physical 16159877 , (Europe PMC )NA BioGRID STAT2 Affinity Capture-Western physical 22238643 , (Europe PMC )NA BioGRID STIP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STK4 tandem affinity purification association 23386615 , (Europe PMC )0.35 IntAct STMN1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STRN Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct STUB1 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID STUB1 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct SUPT5H Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct SYCE1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TARBP2 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID TARBP2 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct TARDBP Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TARS Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TBC1D1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TBC1D3B Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TCPT Affinity Capture-Western physical 25277244 , (Europe PMC )NA BioGRID TES Affinity Capture-MS, Co-fractionation physical 26344197 , 28378594 , (Europe PMC )NA BioGRID TGFB1I1 Affinity Capture-Western, Two-hybrid physical 11546764 , 24831009 , (Europe PMC )NA BioGRID THOC5 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TJP2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TKT Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TMCO3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TNF Affinity Capture-RNA physical 21245386 , (Europe PMC )NA BioGRID TOMM70 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID TOMM70 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct TOX4 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TP53 Affinity Capture-Western, Co-localization, Two-hybrid, anti bait coimmunoprecipitation, proximity ligation assay, two hybrid pooling approach physical, physical association 16169070 , 17184779 , 25241761 , (Europe PMC )0.69 BioGRID, IntAct, MINT TPM3 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TPT1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct TRIM24 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TRIM25 Affinity Capture-MS physical 29117863 , (Europe PMC )NA BioGRID TRIM54 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TSC22D1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TSNAXIP1 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID TSNAXIP1 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct TTC3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TTC39C Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TUBA1A pull down association 27291054 , (Europe PMC )0.35 IntAct TUBA1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TUBA4A Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TUBB3 pull down association 27291054 , (Europe PMC )0.35 IntAct TXNL1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct TYK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct UAP1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UBA2 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UBC Affinity Capture-MS physical 16196087 , (Europe PMC )NA BioGRID UBE2I Affinity Capture-Western physical 19597476 , 23155000 , (Europe PMC )NA BioGRID UBE2N Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UBL4A Affinity Capture-MS physical 23246001 , (Europe PMC )NA BioGRID UCHL5 Reconstituted Complex physical 21800051 , (Europe PMC )NA BioGRID UFD1 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID UFD1 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct UGDH Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID UNG Affinity Capture-Western, Reconstituted Complex physical 10629618 , (Europe PMC )NA BioGRID UQCC2 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct UQCRB Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct USP1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct USP14 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID USP38 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct VCAM1 Affinity Capture-MS, cross-linking study association, physical 19738201 , 22623428 , (Europe PMC )0.35 BioGRID, IntAct VCP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID VIM Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct WASHC3 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID WASHC3 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct WDR66 Two-hybrid physical 25277244 , (Europe PMC )NA BioGRID WDR66 reverse ras recruitment system physical association 25277244 , (Europe PMC )0.37 IntAct WDR83 Two-hybrid, two hybrid physical, physical association 22365833 , (Europe PMC )0.37 BioGRID, IntAct, MINT WWOX Affinity Capture-MS physical 24550385 , (Europe PMC )NA BioGRID WWP1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct XPO1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct XRCC5 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.51 BioGRID, IntAct YAP1 Affinity Capture-MS physical 25796446 , (Europe PMC )NA BioGRID YWHAB Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct YWHAE Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct YWHAH Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct YWHAQ Affinity Capture-MS, Two-hybrid, reverse ras recruitment system physical, physical association 20618440 , 25277244 , (Europe PMC )0.37 BioGRID, IntAct YWHAZ Two-hybrid, pull down, reverse ras recruitment system, tandem affinity purification association, physical, physical association 15161933 , 20618440 , 25277244 , (Europe PMC )0.68 BioGRID, IntAct, MINT ZBTB1 Affinity Capture-MS physical 24657165 , (Europe PMC )NA BioGRID ZBTB17 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZBTB37 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZFAT Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZNF131 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZNF197 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZNRF3 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct ZYX Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
AKT1 S82_RALSRQLsSGVSEIR , NA NA PhosphoSitePlus , MAPK14 S176_MPKLATQsNEITIPV , NA NA PhosphoSitePlus , MAPKAPK2 S15_FSLLRGPsWDPFRDW , S78_PAYSRALsRQLSSGV , S82_RALSRQLsSGVSEIR , LTP, in vitro, in vivo 10383393 , 1332886 , 16565220 , 16964243 , 17924679 , 18088087 , 18212344 , 18578522 , 18669648 , 18691976 , 18707149 , 18767875 , 19007248 , 19415658 , 19562805 , 19651622 , 19664994 , 19664995 , 19691289 , 20058876 , 20068231 , 20166139 , 20230923 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , MAPKAPK3 S15_FSLLRGPsWDPFRDW , S78_PAYSRALsRQLSSGV , S82_RALSRQLsSGVSEIR , in vitro, in vivo 1332886 , 16565220 , 16964243 , 17924679 , 18088087 , 18212344 , 18578522 , 18669648 , 18691976 , 18707149 , 18767875 , 19007248 , 19415658 , 19562805 , 19651622 , 19664994 , 19664995 , 19691289 , 20058876 , 20068231 , 20166139 , 20230923 ,(Europe PMC )HPRD, PKD1 S82_RALSRQLsSGVSEIR , LTP 15728188 ,(Europe PMC )PhosphoELM , PRKACA S78_PAYSRALsRQLSSGV , S82_RALSRQLsSGVSEIR , T143_RCFTRKYtLPPGVDP , NA NA PhosphoSitePlus , PRKD1 S82_RALSRQLsSGVSEIR , NA NA PhosphoSitePlus , PRKG1 S15_FSLLRGPsWDPFRDW , S78_PAYSRALsRQLSSGV , S82_RALSRQLsSGVSEIR , T143_RCFTRKYtLPPGVDP , NA NA PhosphoSitePlus , RPS6KB2 S78_PAYSRALsRQLSSGV , S82_RALSRQLsSGVSEIR , NA NA PhosphoSitePlus , Unknown S135_QDEHGYIsRCFTRKY , S15_FSLLRGPsWDPFRDW , S199_GGPEAAKsDETAAK , S26_FRDWYPHsRLFDQAF , S65_LPPAAIEsPAVAAPA , S78_PAYSRALsRQLSSGV , S82_RALSRQLsSGVSEIR , S83_ALSRQLSsGVSEIRH , S86_RQLSSGVsEIRHTAD , S98_TADRWRVsLDVNHFA , T110_HFAPDELtVKTKDGV , T113_PDELTVKtKDGVVEI , T121_KDGVVEItGKHEERQ , T174_APMPKLAtQSNEITI , T91_GVSEIRHtADRWRVS , HTP, LTP, in vitro, in vivo 11383510 , 12096113 , 1332886 , 15302935 , 16097034 , 16565220 , 16964243 , 17081983 , 17924679 , 18088087 , 18212344 , 18578522 , 18669648 , 18691976 , 18707149 , 18767875 , 19007248 , 19415658 , 19562805 , 19651622 , 19664994 , 19664995 , 19691289 , 20058876 , 20068231 , 20166139 , 20230923 ,(Europe PMC )HPRD, PhosphoELM , p70S6Kb S78_PAYSRALsRQLSSGV , S82_RALSRQLsSGVSEIR , LTP 1730670 ,(Europe PMC )PhosphoELM ,