Top
CRK
Localization (UniProt annotation) Cytoplasm Cell membrane Note=Translocated to the plasma membrane upon celladhesion Function (UniProt annotation) Isoform Crk-II: Regulates cell adhesion, spreading andmigration Mediates attachment-induced MAPK8 activation, membraneruffling and cell motility in a Rac-dependent manner Involved inphagocytosis of apoptotic cells and cell motility via itsinteraction with DOCK1 and DOCK4 May regulate the EFNA5-EPHA3signaling Catalytic Activity (UniProt annotation) N/A Protein Sequence MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPP
GVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILR
IRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) hsa04010 MAPK signaling pathway The mitogen-activated protein kinase (MAPK) cascade is a highly conserved module that is involved in various cellular functions, including cell proliferation, differentiation and migration. Mammals express at least four distinctly regulated groups of MAPKs, extracellular signal-related kinases (ERK)-1/2, Jun amino-terminal kinases (JNK1/2/3), p38 proteins (p38alpha/beta/gamma/delta) and ERK5, that are activated by specific MAPKKs: MEK1/2 for ERK1/2, MKK3/6 for the p38, MKK4/7 (JNKK1/2) for the JNKs, and MEK5 for ERK5. Each MAPKK, however, can be activated by more than one MAPKKK, increasing the complexity and diversity of MAPK signalling. Presumably each MAPKKK confers responsiveness to distinct stimuli. For example, activation of ERK1/2 by growth factors depends on the MAPKKK c-Raf, but other MAPKKKs may activate ERK1/2 in response to pro-inflammatory stimuli. hsa04012 ErbB signaling pathway The ErbB family of receptor tyrosine kinases (RTKs) couples binding of extracellular growth factor ligands to intracellular signaling pathways regulating diverse biologic responses, including proliferation, differentiation, cell motility, and survival. Ligand binding to the four closely related members of this RTK family -epidermal growth factor receptor (EGFR, also known as ErbB-1 or HER1), ErbB-2 (HER2), ErbB-3 (HER3), and ErbB-4 (HER4)-induces the formation of receptor homo- and heterodimers and the activation of the intrinsic kinase domain, resulting in phosphorylation on specific tyrosine residues (pY) within the cytoplasmic tail. Signaling effectors containing binding pockets for pY-containing peptides are recruited to activated receptors and induce the various signaling pathways. The Shc- and/or Grb2-activated mitogen-activated protein kinase (MAPK) pathway is a common target downstream of all ErbB receptors. Similarly, the phosphatidylinositol-3-kinase (PI-3K) pathway is directly or indirectly activated by most ErbBs. Several cytoplasmic docking proteins appear to be recruited by specific ErbB receptors and less exploited by others. These include the adaptors Crk, Nck, the phospholipase C gamma (PLCgamma), the intracellular tyrosine kinase Src, or the Cbl E3 ubiquitin protein ligase. hsa04015 Rap1 signaling pathway Rap1 is a small GTPase that controls diverse processes, such as cell adhesion, cell-cell junction formation and cell polarity. Like all G proteins, Rap1 cycles between an inactive GDP-bound and an active GTP-bound conformation. A variety of extracellular signals control this cycle through the regulation of several unique guanine nucleotide exchange factors (GEFs) and GTPase activating proteins (GAPs). Rap1 plays a dominant role in the control of cell-cell and cell-matrix interactions by regulating the function of integrins and other adhesion molecules in various cell types. Rap1 also regulates MAP kinase (MAPK) activity in a manner highly dependent on the context of cell types. hsa04062 Chemokine signaling pathway Inflammatory immune response requires the recruitment of leukocytes to the site of inflammation upon foreign insult. Chemokines are small chemoattractant peptides that provide directional cues for the cell trafficking and thus are vital for protective host response. In addition, chemokines regulate plethora of biological processes of hematopoietic cells to lead cellular activation, differentiation and survival.The chemokine signal is transduced by chemokine receptors (G-protein coupled receptors) expressed on the immune cells. After receptor activation, the alpha- and beta-gamma-subunits of G protein dissociate to activate diverse downstream pathways resulting in cellular polarization and actin reorganization. Various members of small GTPases are involved in this process. Induction of nitric oxide and production of reactive oxygen species are as well regulated by chemokine signal via calcium mobilization and diacylglycerol production. hsa04510 Focal adhesion Cell-matrix adhesions play essential roles in important biological processes including cell motility, cell proliferation, cell differentiation, regulation of gene expression and cell survival. At the cell-extracellular matrix contact points, specialized structures are formed and termed focal adhesions, where bundles of actin filaments are anchored to transmembrane receptors of the integrin family through a multi-molecular complex of junctional plaque proteins. Some of the constituents of focal adhesions participate in the structural link between membrane receptors and the actin cytoskeleton, while others are signalling molecules, including different protein kinases and phosphatases, their substrates, and various adapter proteins. Integrin signaling is dependent upon the non-receptor tyrosine kinase activities of the FAK and src proteins as well as the adaptor protein functions of FAK, src and Shc to initiate downstream signaling events. These signalling events culminate in reorganization of the actin cytoskeleton; a prerequisite for changes in cell shape and motility, and gene expression. Similar morphological alterations and modulation of gene expression are initiated by the binding of growth factors to their respective receptors, emphasizing the considerable crosstalk between adhesion- and growth factor-mediated signalling. hsa04666 Fc gamma R-mediated phagocytosis Phagocytosis plays an essential role in host-defense mechanisms through the uptake and destruction of infectious pathogens. Specialized cell types including macrophages, neutrophils, and monocytes take part in this process in higher organisms. After opsonization with antibodies (IgG), foreign extracellular materials are recognized by Fc gamma receptors. Cross-linking of Fc gamma receptors initiates a variety of signals mediated by tyrosine phosphorylation of multiple proteins, which lead through the actin cytoskeleton rearrangements and membrane remodeling to the formation of phagosomes. Nascent phagosomes undergo a process of maturation that involves fusion with lysosomes. The acquisition of lysosomal proteases and release of reactive oxygen species are crucial for digestion of engulfed materials in phagosomes. hsa04722 Neurotrophin signaling pathway Neurotrophins are a family of trophic factors involved in differentiation and survival of neural cells. The neurotrophin family consists of nerve growth factor (NGF), brain derived neurotrophic factor (BDNF), neurotrophin 3 (NT-3), and neurotrophin 4 (NT-4). Neurotrophins exert their functions through engagement of Trk tyrosine kinase receptors or p75 neurotrophin receptor (p75NTR). Neurotrophin/Trk signaling is regulated by connecting a variety of intracellular signaling cascades, which include MAPK pathway, PI-3 kinase pathway, and PLC pathway, transmitting positive signals like enhanced survival and growth. On the other hand, p75NTR transmits both positive and nagative signals. These signals play an important role for neural development and additional higher-order activities such as learning and memory. hsa04810 Regulation of actin cytoskeleton hsa04910 Insulin signaling pathway Insulin binding to its receptor results in the tyrosine phosphorylation of insulin receptor substrates (IRS) by the insulin receptor tyrosine kinase (INSR). This allows association of IRSs with the regulatory subunit of phosphoinositide 3-kinase (PI3K). PI3K activates 3-phosphoinositide-dependent protein kinase 1 (PDK1), which activates Akt, a serine kinase. Akt in turn deactivates glycogen synthase kinase 3 (GSK-3), leading to activation of glycogen synthase (GYS) and thus glycogen synthesis. Activation of Akt also results in the translocation of GLUT4 vesicles from their intracellular pool to the plasma membrane, where they allow uptake of glucose into the cell. Akt also leads to mTOR-mediated activation of protein synthesis by eIF4 and p70S6K. The translocation of GLUT4 protein is also elicited through the CAP/Cbl/TC10 pathway, once Cbl is phosphorylated by INSR.Other signal transduction proteins interact with IRS including GRB2. GRB2 is part of the cascade including SOS, RAS, RAF and MEK that leads to activation of mitogen-activated protein kinase (MAPK) and mitogenic responses in the form of gene transcription. SHC is another substrate of INSR. When tyrosine phosphorylated, SHC associates with GRB2 and can thus activate the RAS/MAPK pathway independently of IRS-1. hsa05100 Bacterial invasion of epithelial cells Many pathogenic bacteria can invade phagocytic and non-phagocytic cells and colonize them intracellularly, then become disseminated to other cells. Invasive bacteria induce their own uptake by non-phagocytic host cells (e.g. epithelial cells) using two mechanisms referred to as zipper model and trigger model. Listeria, Staphylococcus, Streptococcus, and Yersinia are examples of bacteria that enter using the zipper model. These bacteria express proteins on their surfaces that interact with cellular receptors, initiating signalling cascades that result in close apposition of the cellular membrane around the entering bacteria. Shigella and Salmonella are the examples of bacteria entering cells using the trigger model. These bacteria use type III secretion systems to inject protein effectors that interact with the actin cytoskeleton. hsa05131 Shigellosis Shigellosis, or bacillary dysentery, is an intestinal infection caused by Shigella, a genus of enterobacteria. Shigella are potential food-borne pathogens that are capable of colonizing the intestinal epithelium by exploiting epithelial-cell functions and circumventing the host innate immune response. During basolateral entry into the host-cell cytoplasm, Shigella deliver a subset of effectors into the host cells through the type III secretion system. The effectors induce membrane ruffling through the stimulation of the Rac1-WAVE-Arp2/3 pathway, enabling bacterial entry into the epithelial cells. During multiplication within the cells, Shigella secrete another subset of effectors. VirG induces actin polymerization at one pole of the bacteria, allowing the bacteria to spread intracellularly and to infect adjacent cells. OspF, OspG and IpaH(9.8) downregulate the production of proinflammatory cytokines such as IL-8, helping bacteria circumvent the innate immune response. hsa05163 Human cytomegalovirus infection Human cytomegalovirus (HCMV) is an enveloped, double-stranded DNA virus that is a member of beta-herpesvirus family. HCMV is best known for causing significant morbidity and mortality in immunocompromised populations. As with other herpesviruses, HCMV gB and gH/gL envelope glycoproteins are essential for virus entry. HCMV gB could activate the PDGFRA, and induce activation of the oncogenic PI3-K/AKT pathway. Though it is unlikely that HCMV by itself can act as an oncogenic factor, HCMV may have an oncomodulatory role, to catalyze an oncogenic process that has already been initiated. US28, one of the four HCMV-encoded vGPCRs (US27, US28, UL33 and UL78), also has a specific role in the oncomodulatory properties. In addition, HCMV has developed numerous mechanisms for manipulating the host immune system. The virally encoded US2, US3, US6 and US11 gene products all interfere with major histocompatibility complex (MHC) class I antigen presentation. HCMV encodes several immediate early (IE) antiapoptotic proteins (IE1, IE2, vMIA and vICA). These proteins might avoid immune clearance of infected tumor cells by cytotoxic lymphocytes and NK cells. hsa05170 Human immunodeficiency virus 1 infection Human immunodeficiency virus type 1 (HIV-1) , the causative agent of AIDS (acquired immunodeficiency syndrome), is a lentivirus belonging to the Retroviridae family. The primary cell surface receptor for HIV-1, the CD4 protein, and the co-receptor for HIV-1, either CCR5 or CXCR4, are found on macrophages and T lymphocytes. At the earliest step, sequential binding of virus envelope (Env) glycoprotein gp120 to CD4 and the co-receptor CCR5 or CXCR4 facilitates HIV-1 entry and has the potential to trigger critical signaling that may favor viral replication. At advanced stages of the disease, HIV-1 infection results in dramatic induction of T-cell (CD4+ T and CD8+ T cell) apoptosis both in infected and uninfected bystander T cells, a hallmark of HIV-1 pathogenesis. On the contrary, macrophages are resistant to the cytopathic effect of HIV-1 and produce virus for longer periods of time. hsa05200 Pathways in cancer hsa05206 MicroRNAs in cancer MicroRNA (miRNA) is a cluster of small non-encoding RNA molecules of 21 - 23 nucleotides in length, which controls gene expression post-transcriptionally either via the degradation of target mRNAs or the inhibition of protein translation. Using high-throughput profiling, dysregulation of miRNAs has been widely observed in different stages of cancer. The upregulation (overexpression) of specific miRNAs could lead to the repression of tumor suppressor gene expression, and conversely the downregulation of specific miRNAs could result in an increase of oncogene expression; both these situations induce subsequent malignant effects on cell proliferation, differentiation, and apoptosis that lead to tumor growth and progress. The miRNA signatures of cancer observed in various studies differ significantly. These inconsistencies occur due to the differences in the study populations and methodologies used. This pathway map shows the summarized results from various studies in 9 cancers, each of which is presented in a review article. hsa05211 Renal cell carcinoma Renal cell cancer (RCC) accounts for ~3% of human malignancies and its incidence appears to be rising. Although most cases of RCC seem to occur sporadically, an inherited predisposition to renal cancer accounts for 1-4% of cases. RCC is not a single disease, it has several morphological subtypes. Conventional RCC (clear cell RCC) accounts for ~80% of cases, followed by papillary RCC (10-15%), chromophobe RCC (5%), and collecting duct RCC (<1%). Genes potentially involved in sporadic neoplasms of each particular type are VHL, MET, BHD, and FH respectively. In the absence of VHL, hypoxia-inducible factor alpha (HIF-alpha) accumulates, leading to production of several growth factors, including vascular endothelial growth factor and platelet-derived growth factor. Activated MET mediates a number of biological effects including motility, invasion of extracellular matrix, cellular transformation, prevention of apoptosis and metastasis formation. Loss of functional FH leads to accumulation of fumarate in the cell, triggering inhibition of HPH and preventing targeted pVHL-mediated degradation of HIF-alpha. BHD mutations cause the Birt-Hogg-Dube syndrome and its associated chromophobe, hybrid oncocytic, and conventional (clear cell) RCC. hsa05220 Chronic myeloid leukemia Chronic myeloid leukemia (CML) is a clonal myeloproliferative disorder of a pluripotent stem cell. The natural history of CML has a triphasic clinical course comprising of an initial chronic phase (CP), which is characterized by expansion of functionally normal myeloid cells, followed by an accelerated phase (AP) and finally a more aggressive blast phase (BP), with loss of terminal differentiation capacity. On the cellular level, CML is associated with a specific chromosome abnormality, the t(9; 22) reciprocal translocation that forms the Philadelphia (Ph) chromosome. The Ph chromosome is the result of a molecular rearrangement between the c-ABL proto-oncogene on chromosome 9 and the BCR (breakpoint cluster region) gene on chromosome 22. The BCR/ABL fusion gene encodes p210 BCR/ABL, an oncoprotein, which, unlike the normal p145 c-Abl, has constitutive tyrosine kinase activity and is predominantly localized in the cytoplasm. While fusion of c-ABL and BCR is believed to be the primary cause of the chronic phase of CML, progression to blast crisis requires other molecular changes. Common secondary abnormalities include mutations in TP53, RB, and p16/INK4A, or overexpression of genes such as EVI1. Additional chromosome translocations are also observed,such as t(3;21)(q26;q22), which generates AML1-EVI1.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-170984 ARMS-mediated activation. ARMS (Ankyrin-Rich Membrane Spanning/Kidins 220) is a 220kD tetraspanning adaptor protein which becomes rapidly tyrosine phosphorylated by active Trk receptors. ARMS is another adaptor protein which is involved in the activation of Rap1 and the subsequent prolonged activation of the MAPK cascade R-HSA-186763 Downstream signal transduction. The role of autophosphorylation sites on PDGF receptors are to provide docking sites for downstream signal transduction molecules which contain SH2 domains. The SH2 domain is a conserved motif of around 100 amino acids that can bind a phosphorylated tyrosine residue. These downstream molecules are activated upon binding to, or phosphorylated by, the receptor kinases intrinsic to PDGF receptors.Some of the dowstream molecules are themselves enzymes, such as phosphatidylinositol 3'-kinase (PI3K), phospholipase C (PLC-gamma), the Src family of tyrosine kinases, the tyrosine phosphatase SHP2, and a GTPase activating protein (GAP) for Ras. Others such as Grb2 are adaptor molecules which link the receptor with downstream catalytic molecules R-HSA-2029482 Regulation of actin dynamics for phagocytic cup formation. The actin cytoskeleton is fundamental for phagocytosis and members of the Rho family GTPases RAC and CDC42 are involved in actin cytoskeletal regulation leading to pseudopod extension. Active RAC and CDC42 exert their action through the members of WASP family proteins (WASP/N-WASP/WAVE) and ARP2/3 complex. Actin filaments move from the bottom toward the top of the phagocytic cup during pseudopod extension R-HSA-372708 p130Cas linkage to MAPK signaling for integrins. Integrin signaling is linked to the MAP kinase pathway by recruiting p130cas and Crk to the FAK/Src activation complex R-HSA-4420097 VEGFA-VEGFR2 Pathway. Angiogenesis is the formation of new blood vessels from preexisting vasculature. One of the most important proangiogenic factors is vascular endothelial growth factor (VEGF). VEGF exerts its biologic effect through interaction with transmembrane tyrosine kinase receptors VEGFR, selectively expressed on vascular endothelial cells. VEGFA signaling through VEGFR2 is the major pathway that activates angiogenesis by inducing the proliferation, survival, sprouting and migration of endothelial cells (ECs), and also by increasing endothelial permeability (Lohela et al. 2009, Shibuya & Claesson-Welsh 2006, Claesson-Welsh & Welsh, 2013). The critical role of VEGFR2 in vascular development is highlighted by the fact that VEGFR2-/- mice die at E8.5-9.5 due to defective development of blood islands, endothelial cells and haematopoietic cells (Shalaby et al. 1995) R-HSA-8849471 PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases. PTK6 promotes cell motility and migration by regulating the activity of RHO GTPases RAC1 (Chen et al. 2004) and RHOA (Shen et al. 2008). PTK6 inhibits RAS GTPase activating protein RASA1 (Shen et al. 2008) and may be involved in MAPK7 (ERK5) activation (Ostrander et al. 2007, Zheng et al R-HSA-8875555 MET activates RAP1 and RAC1. The adapter protein GAB1 is involved in recruitment, through CRK and related CRKL proteins, of guanyl nucleotide exchange factors (GEFs) to the activated MET receptor. MET-associated GEFs, such as RAPGEF1 (C3G) and DOCK7, activate RAP1 and RAC1, respectively, leading to morphological changes that contribute to cell motility (Schaeper et al. 2000, Sakkab et al. 2000, Lamorte et al. 2002, Watanabe et al. 2006, Murray et al. 2014) R-HSA-8875656 MET receptor recycling. Activated MET receptor is subject to recycling from the plasma membrane through the endosomal compartment and back to the plasma membrane (Peschard et al. 2001, Hammond et al. 2001, Petrelli et al. 2002). In the recycling process, activated MET receptor is endocytosed, and the GGA3 protein directs it, via a largely unknown mechanism, through the RAB4 positive endosomal compartments back to the plasma membrane (Parachoniak et al. 2011). Endosomal signaling by MET during the recycling process appears to play an important role in sustained activation of ERK1/ERK2 (MAPK3/MAPK1) and STAT3 downstream of MET (Kermorgant and Parker 2008) R-HSA-912631 Regulation of signaling by CBL. Cbl is an E3 ubiquitin-protein ligase that negatively regulates signaling pathways by targeting proteins for ubiquitination and proteasomal degradation (Rao et al. 2002). Cbl negatively regulates PI3K via this mechanism (Dufour et al. 2008). The binding of Cbl to the p85 subunit of PI3K is mediated at least in part by tyrosine phosphorylation at Y731 (Dufour et al. 2008). Fyn and the related kinases Hck and Lyn are known to be associated with Cbl (Anderson et al. 1997, Hunter et al. 1999). Fyn is proven capable of Cbl Y731 phosphorylation (Hunter et al. 1999).The association of Fyn and Cbl has been described as constitutive (Hunter et al. 1999). CBL further associates with the p85 subunit of PI3K (Hartley et al. 1995, Anderson et al. 1997, Hunter et al. 1997), this also described as constitutive and mediated by the SH3 domain of p85. Binding of the SH2 domain of p85 to a specific phosphorylation site in Cbl is postulated to explain the the increase in Cbl/p85 association seen in activated cells (Panchamoorthy et al 1996) which negatively regulates PI3K activity (Fang et al. 2001). The negative effect of increased Cbl-PI3K interaction is mediated by Y731 of Cbl. Cbl binding increases PI3K ubiquitination and proteasome degradation (Dufour et al. 2008).Cbl is constitutively associated with Grb in resting hematopoietic cells (Anderson et al. 1997, Odai et al. 1995, Park et al. 1998, Panchamoorthy et al. 1996). Both the SH2 and SH3 domains of Grb2 are involved. Cbl has 2 distinct C-terminal domains, proximal and distal. The proximal domain binds Grb2 in resting and stimulated cells, and in stimulated cells also binds Shc. The distal domain binds the adaptor protein CRKL. Tyrosine phosphorylation of Cbl in response to IL-3 releases the SH3 domain of Grb2 which then is free to bind other molecules (Park et al. 1998). Cbl is tyrosine phosphorylated in response to many cytokines including IL-3, IL-2 (Gesbert et al. 1998) and IL-4 (Ueno et al. 1998)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABL1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, nuclear magnetic resonance, peptide array, protein kinase assay, pull down association, phosphorylation reaction, physical, physical association 12097319 , 12384576 , 15696159 , 17474147 , 17515907 , 18619508 , 18835194 , 19380743 , 24412932 , 8194526 , 9747873 , (Europe PMC )0.35, 0.44, 0.56 BioGRID, IntAct, MINT ABL2 Affinity Capture-MS, Biochemical Activity, Reconstituted Complex, Two-hybrid, peptide array, protein kinase assay, tandem affinity purification, two hybrid array, validated two hybrid association, phosphorylation reaction, physical, physical association 15886098 , 17474147 , 19380743 , 25814554 , 8194526 , (Europe PMC )0.49, 0.70 BioGRID, IntAct ACTB Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID AGO1 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct AGO2 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct ANKZF1 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct ANLN Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct AP2A1 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct AP2B1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID AP2M1 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct ARHGAP17 Reconstituted Complex physical 11431473 , (Europe PMC )NA BioGRID ARHGAP32 Affinity Capture-Western, Reconstituted Complex physical 12454018 , 12819203 , (Europe PMC )NA BioGRID ARPC1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ASAP1 Affinity Capture-MS, Reconstituted Complex, peptide array physical, physical association 17474147 , 19380743 , 9819391 , (Europe PMC )0.40 BioGRID, IntAct ASAP3 Affinity Capture-MS, bimolecular fluorescence complementation, tandem affinity purification, two hybrid array, two hybrid prey pooling approach, validated two hybrid association, physical, physical association 19380743 , 26871637 , (Europe PMC )0.70 BioGRID, IntAct ASB9 Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array physical, physical association 25814554 , (Europe PMC )0.51 BioGRID, IntAct ASCL4 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct ATF3 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct ATIC Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID ATXN1 Affinity Capture-Western, Two-hybrid, pull down, two hybrid array, two hybrid prey pooling approach physical, physical association 16713569 , 23275563 , (Europe PMC )0.63 BioGRID, IntAct AVIL Reconstituted Complex physical 11287316 , (Europe PMC )NA BioGRID BAG3 Affinity Capture-Luminescence, Affinity Capture-MS physical 23824909 , (Europe PMC )NA BioGRID BATF3 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct BCAR1 Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10085298 , 10329689 , 10464310 , 10747099 , 10753828 , 11278916 , 11369773 , 11839772 , 12615911 , 12799422 , 14657239 , 15492270 , 15673687 , 16267043 , 17038317 , 18835194 , 19380743 , 22974441 , 9581808 , 9920935 , (Europe PMC )0.76 BioGRID, IntAct, MINT BCR Affinity Capture-MS, Reconstituted Complex physical 19380743 , 8943292 , (Europe PMC )NA BioGRID BEX5 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct BUB1 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct C4orf17 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct C6orf141 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct CASS4 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct CAST Co-fractionation, peptide array physical, physical association 17474147 , 26344197 , (Europe PMC )0.40 BioGRID, IntAct CBL Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 10962563 , 11792427 , 12393469 , 15581361 , 16289966 , 18835194 , 19380743 , 22974441 , 25814554 , 8524328 , 8621483 , 8626404 , 8626543 , 8662998 , 8683103 , 8943292 , 9129019 , 9178909 , 9416834 , 9461587 , 9617486 , 9988765 , (Europe PMC )0.49, 0.88 BioGRID, IntAct, MINT CBLB Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 19380743 , 25814554 , (Europe PMC )0.49, 0.62 BioGRID, IntAct CBLC Reconstituted Complex, Two-hybrid, two hybrid array, validated two hybrid physical, physical association 10362357 , 25814554 , (Europe PMC )0.49 BioGRID, IntAct CCP110 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CDH1 Proximity Label-MS physical 25468996 , (Europe PMC )NA BioGRID CEP128 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CEP19 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CEP89 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CHTF18 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct CLNK Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct CNDP2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct CORO1C Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID CORO6 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct COX6C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CSE1L Affinity Capture-Western physical 8943292 , (Europe PMC )NA BioGRID DDX3X Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID DDX5 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID DDX6 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct DHX9 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID DNAJA3 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID DOCK1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex, peptide array, pull down association, physical, physical association 10559471 , 11369773 , 12615911 , 15673687 , 17474147 , 17515907 , 26344197 , 8657152 , 8662907 , (Europe PMC )0.35, 0.40 BioGRID, IntAct DOK1 Protein-peptide physical 22974441 , (Europe PMC )NA BioGRID DOK2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct DOK3 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct DOK7 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct DPPA4 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 26871637 , (Europe PMC )0.67 BioGRID, IntAct DSC1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID EDC4 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct EEF1A1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID EFS Far Western, peptide array physical, physical association 17474147 , 8647432 , (Europe PMC )0.40 BioGRID, IntAct EGFR Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, PCA, Protein-peptide, Two-hybrid, luminescence based mammalian interactome mapping, protein array, ubiquitin reconstruction direct interaction, physical, physical association 10595738 , 16273093 , 16729043 , 24658140 , 25402006 , 9617486 , 9642287 , (Europe PMC )0.51, 0.59 BioGRID, IntAct, MINT ELK1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct EPHA3 Affinity Capture-Western physical 11870224 , (Europe PMC )NA BioGRID EPHB2 Reconstituted Complex physical 10644995 , (Europe PMC )NA BioGRID EPHB3 Reconstituted Complex physical 9674711 , (Europe PMC )NA BioGRID EPS15 Affinity Capture-MS, Far Western, Reconstituted Complex, tandem affinity purification association, physical 19380743 , 7797522 , (Europe PMC )0.35 BioGRID, IntAct EPYC Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct ERBB2 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT ERBB3 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT ERBB4 Affinity Capture-MS physical 16729043 , (Europe PMC )NA BioGRID ESD Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct EYA3 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct FASLG Protein-peptide, phage display direct interaction, physical 19807924 , (Europe PMC )0.44 BioGRID, IntAct FER Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct FGFR1 Affinity Capture-Western, Co-localization, Reconstituted Complex, affinity chromatography technology, proximity ligation assay association, physical, physical association 10464310 , 25241761 , (Europe PMC )0.56 BioGRID, IntAct, MINT FLNA Co-localization, peptide array, proximity ligation assay physical, physical association 17474147 , 25241761 , (Europe PMC )0.59 BioGRID, IntAct FRS2 Reconstituted Complex physical 10092678 , (Europe PMC )NA BioGRID FSTL1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct FUBP1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID GAB1 Affinity Capture-MS, fluorescence polarization spectroscopy direct interaction, physical 19380743 , 24728074 , (Europe PMC )0.44 BioGRID, IntAct GAB2 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID GABPB2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct GAREM1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct GFPT1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GGA3 Affinity Capture-Western physical 21664574 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, tandem affinity purification association, physical 10962563 , 10970810 , 19380743 , 8662907 , 8810325 , (Europe PMC )0.35 BioGRID, IntAct HABP4 Two-hybrid physical 25814554 , (Europe PMC )NA BioGRID HIST1H1D Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID HSH2D Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct HSP90AB1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HSPA1B Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HSPA1L Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HSPA5 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HSPA6 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HSPA9 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HSPB1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID HSPBP1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HUWE1 Affinity Capture-MS physical 25147182 , (Europe PMC )NA BioGRID IFT140 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct INF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct INO80E Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct INPPL1 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct IRS4 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down association, physical 11316748 , 9614078 , (Europe PMC )0.46 BioGRID, IntAct, MINT ISL1 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct KAT6A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KCTD13 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct KCTD17 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct KHDRBS1 Reconstituted Complex physical 1545818 , (Europe PMC )NA BioGRID KIT Two-hybrid, fluorescence polarization spectroscopy, pull down association, direct interaction, physical 12878163 , 24728074 , 9233773 , (Europe PMC )0.59 BioGRID, IntAct, MINT KLF15 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct KLHL20 Two-hybrid physical 25814554 , (Europe PMC )NA BioGRID KRT1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT10 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT12 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT14 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT15 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT16 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT17 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT19 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT2 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT24 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT3 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT4 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT5 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT6A Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT6B Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT73 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT76 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT77 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT78 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT79 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT8 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT9 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID LASP1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct LHX8 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct LMNA Proximity Label-MS physical 22412018 , (Europe PMC )NA BioGRID LYZ Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID MAGEC3 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct MAP4K1 Affinity Capture-Western, Reconstituted Complex, peptide array, pull down physical, physical association 11279207 , 17474147 , 9788432 , 9891069 , (Europe PMC )0.59 BioGRID, IntAct MAP4K5 Affinity Capture-MS, Affinity Capture-Western, coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 10648385 , 19380743 , 9788432 , (Europe PMC )0.64 BioGRID, IntAct MAPK4 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MAPK8 Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay, pull down physical, physical association 11432831 , 16982329 , 25241761 , (Europe PMC )0.59 BioGRID, IntAct, MINT MET Affinity Capture-Western, fluorescence polarization spectroscopy direct interaction, physical 24728074 , 24828152 , (Europe PMC )0.44 BioGRID, IntAct MICAL1 Reconstituted Complex physical 11827972 , (Europe PMC )NA BioGRID MNDA Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct MPDZ Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MPG Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct MRPL48 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYLIP Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct MYOZ2 Two-hybrid physical 25814554 , (Europe PMC )NA BioGRID NANS Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID NCKIPSD Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID NEDD9 Affinity Capture-Western, Reconstituted Complex physical 8879209 , 9295052 , 9497377 , (Europe PMC )NA BioGRID NUFIP2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct NUMA1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID ODF2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct OFCC1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PAFAH1B2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PDGFRA Affinity Capture-Western, Co-localization, Reconstituted Complex, coimmunoprecipitation, enzymatic study, proximity ligation assay, pull down association, physical, physical association 10733900 , 25241761 , 9546424 , (Europe PMC )0.71 BioGRID, IntAct, MINT PDGFRB Affinity Capture-Western, Reconstituted Complex, pull down association, physical 10733900 , (Europe PMC )0.35 BioGRID, IntAct, MINT PEAK1 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 19380743 , 20534451 , (Europe PMC )0.35 BioGRID, IntAct PHC2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PIK3C2B Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID PIK3CA Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID PIK3CB Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID PIK3CD Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID PIK3R1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Two-hybrid, proximity ligation assay, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 10962563 , 11418612 , 19380743 , 25241761 , 25814554 , (Europe PMC )0.49, 0.56 BioGRID, IntAct PIK3R2 Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 19380743 , 25814554 , (Europe PMC )0.35, 0.49 BioGRID, IntAct PIK3R3 Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 19380743 , 25814554 , (Europe PMC )0.49, 0.62 BioGRID, IntAct PLSCR1 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct POT1 Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct PPFIBP2 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 19447967 , 26871637 , (Europe PMC )0.67 BioGRID, IntAct PPP1CA Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PPP1R12A Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PRKACA Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PRRC2B Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct PRRG2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PSMC1 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct PSMC6 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 26871637 , (Europe PMC )0.76 BioGRID, IntAct PTK2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array, validated two hybrid physical, physical association 10085298 , 12615911 , 25814554 , 7561682 , (Europe PMC )0.63 BioGRID, IntAct PTPN1 Reconstituted Complex physical 8940134 , (Europe PMC )NA BioGRID PTPN11 Affinity Capture-MS, Affinity Capture-Western physical 10464310 , 19380743 , (Europe PMC )NA BioGRID PTPN4 Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, confocal microscopy, two hybrid colocalization, physical, physical association 21988832 , (Europe PMC )0.54 BioGRID, IntAct PTTG1 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct PXN Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 10085298 , 12198159 , 12799422 , 26656091 , (Europe PMC )0.40 BioGRID, IntAct, MINT RAB2B Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct RAPGEF1 Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, coimmunoprecipitation, peptide array, pull down, tandem affinity purification association, physical, physical association 10464310 , 17474147 , 17515907 , 18835194 , 19380743 , 7512734 , 7531694 , 8621483 , 8943292 , (Europe PMC )0.35, 0.69 BioGRID, IntAct, MINT RET Co-localization, Reconstituted Complex, proximity ligation assay physical, physical association 25241761 , 9393871 , (Europe PMC )0.40 BioGRID, IntAct RIN3 Two-hybrid, peptide array, two hybrid array physical, physical association 17474147 , 25814554 , (Europe PMC )0.57 BioGRID, IntAct RNGTT Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID RPL23 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID RPS19 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID RPS25 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID RPS3 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID RPS5 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID RTCB Two-hybrid physical 25814554 , (Europe PMC )NA BioGRID RYBP Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct SAXO1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SEMA4D Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct SEPT6 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct SERPINB6 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID SERPINH1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SETD9 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct SFN Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID SH2D2A Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct SH3BP1 Reconstituted Complex physical 1379745 , (Europe PMC )NA BioGRID SH3KBP1 Affinity Capture-Western physical 11071869 , (Europe PMC )NA BioGRID SHB Affinity Capture-Western physical 10964504 , (Europe PMC )NA BioGRID SHC1 Affinity Capture-MS, Affinity Capture-Western, proximity ligation assay, tandem affinity purification association, physical, physical association 10464310 , 19380743 , 23397142 , 9617486 , (Europe PMC )0.56 BioGRID, IntAct SLC25A13 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SOCS1 Reconstituted Complex, Two-hybrid, two hybrid array, validated two hybrid physical, physical association 10022833 , 25814554 , (Europe PMC )0.49 BioGRID, IntAct SOCS6 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct SOS1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, peptide array, proximity ligation assay, tandem affinity purification association, physical, physical association 17474147 , 19380743 , 25241761 , 8810325 , 8943292 , (Europe PMC )0.69 BioGRID, IntAct SOS2 Affinity Capture-MS, peptide array, tandem affinity purification association, physical, physical association 17474147 , 19380743 , (Europe PMC )0.56 BioGRID, IntAct SPR Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SPRR2A Reconstituted Complex, protein array direct interaction, physical 18155796 , (Europe PMC )0.44 BioGRID, IntAct, MINT SRC Affinity Capture-Western, proximity ligation assay physical, physical association 10962563 , 12615911 , 23397142 , (Europe PMC )0.40 BioGRID, IntAct SRCIN1 Affinity Capture-Western physical 14657239 , (Europe PMC )NA BioGRID SRM Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STAT4 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct STAT5A Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct STRN4 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct SYN1 Affinity Capture-Western physical 10899172 , (Europe PMC )NA BioGRID TCAP Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct TDG Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct TERF2IP Two-hybrid, bimolecular fluorescence complementation, pull down physical, physical association 21044950 , (Europe PMC )0.51 BioGRID, IntAct TM4SF19 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct TP53 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct TRIM15 Affinity Capture-Western, PCA physical 25450970 , (Europe PMC )NA BioGRID TSG101 Affinity Capture-Western, Co-localization physical 27764233 , (Europe PMC )NA BioGRID TUBA1A Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID TUBA1C Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct TUBA4B Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID TUBB Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID TUBB2A Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID TUBB3 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID TUBB4B Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID TWIST2 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct UBASH3A Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct UBASH3B Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct UBC Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID VAC14 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct WDR83 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct WEE1 Affinity Capture-Western physical 11839808 , (Europe PMC )NA BioGRID XPO1 Two-hybrid physical 11839808 , (Europe PMC )NA BioGRID YWHAG Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID YWHAQ Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID ZAP70 Reconstituted Complex, pull down association, physical 10419455 , 16339550 , (Europe PMC )0.35 BioGRID, IntAct, MINT ZKSCAN7 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct ZNF557 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABAT peptide array physical association 17474147 , (Europe PMC )0.40 IntAct ABI1 array technology direct interaction 20598684 , (Europe PMC )0.44 IntAct, MINT ABL1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, nuclear magnetic resonance, peptide array, protein kinase assay, pull down association, phosphorylation reaction, physical, physical association 12097319 , 12384576 , 15696159 , 17474147 , 17515907 , 18619508 , 18835194 , 19380743 , 24412932 , 8194526 , 9747873 , (Europe PMC )0.35, 0.44, 0.56 BioGRID, IntAct, MINT ABL2 Affinity Capture-MS, Biochemical Activity, Reconstituted Complex, Two-hybrid, peptide array, protein kinase assay, tandem affinity purification, two hybrid array, validated two hybrid association, phosphorylation reaction, physical, physical association 15886098 , 17474147 , 19380743 , 25814554 , 8194526 , (Europe PMC )0.49, 0.70 BioGRID, IntAct AFF2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct AGO1 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct AGO2 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct AGPAT4 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct AIRE peptide array physical association 17474147 , (Europe PMC )0.40 IntAct AKAP2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct AKAP6 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct ALS2CR12 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 26871637 , (Europe PMC )0.56 IntAct ANKZF1 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct ANLN Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct AP2A1 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct AP2M1 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct APOL5 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct AR fluorescence polarization spectroscopy direct interaction 24728074 , (Europe PMC )0.44 IntAct ARHGEF11 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct ARPC1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ASAP1 Affinity Capture-MS, Reconstituted Complex, peptide array physical, physical association 17474147 , 19380743 , 9819391 , (Europe PMC )0.40 BioGRID, IntAct ASAP2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct ASAP3 Affinity Capture-MS, bimolecular fluorescence complementation, tandem affinity purification, two hybrid array, two hybrid prey pooling approach, validated two hybrid association, physical, physical association 19380743 , 26871637 , (Europe PMC )0.70 BioGRID, IntAct ASB9 Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array physical, physical association 25814554 , (Europe PMC )0.51 BioGRID, IntAct ASCL4 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct ATF3 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct ATXN1 Affinity Capture-Western, Two-hybrid, pull down, two hybrid array, two hybrid prey pooling approach physical, physical association 16713569 , 23275563 , (Europe PMC )0.63 BioGRID, IntAct BATF3 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct BCAR1 Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10085298 , 10329689 , 10464310 , 10747099 , 10753828 , 11278916 , 11369773 , 11839772 , 12615911 , 12799422 , 14657239 , 15492270 , 15673687 , 16267043 , 17038317 , 18835194 , 19380743 , 22974441 , 9581808 , 9920935 , (Europe PMC )0.76 BioGRID, IntAct, MINT BEX5 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct BICRA peptide array physical association 17474147 , (Europe PMC )0.40 IntAct BMX peptide array physical association 17474147 , (Europe PMC )0.40 IntAct BRD4 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct BUB1 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct C1orf94 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 26871637 , (Europe PMC )0.56 IntAct C4orf17 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct C6orf141 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct CASS4 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct CAST Co-fractionation, peptide array physical, physical association 17474147 , 26344197 , (Europe PMC )0.40 BioGRID, IntAct CBL Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 10962563 , 11792427 , 12393469 , 15581361 , 16289966 , 18835194 , 19380743 , 22974441 , 25814554 , 8524328 , 8621483 , 8626404 , 8626543 , 8662998 , 8683103 , 8943292 , 9129019 , 9178909 , 9416834 , 9461587 , 9617486 , 9988765 , (Europe PMC )0.49, 0.88 BioGRID, IntAct, MINT CBLB Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 19380743 , 25814554 , (Europe PMC )0.49, 0.62 BioGRID, IntAct CBLC Reconstituted Complex, Two-hybrid, two hybrid array, validated two hybrid physical, physical association 10362357 , 25814554 , (Europe PMC )0.49 BioGRID, IntAct CCP110 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CD93 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct CDH11 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct CELSR2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct CEP128 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CEP19 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CEP89 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CHTF18 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct CLNK Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct CNDP2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct CNTFR peptide array physical association 17474147 , (Europe PMC )0.40 IntAct CNTNAP1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct CORO6 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct COX6C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CSMD2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DDX41 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DDX6 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct DKKL1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DLGAP1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DLGAP2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DLGAP3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DLGAP4 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DLX4 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DNM2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DOCK1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex, peptide array, pull down association, physical, physical association 10559471 , 11369773 , 12615911 , 15673687 , 17474147 , 17515907 , 26344197 , 8657152 , 8662907 , (Europe PMC )0.35, 0.40 BioGRID, IntAct DOCK3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DOK2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct DOK3 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct DOK7 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct DPPA4 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 26871637 , (Europe PMC )0.67 BioGRID, IntAct DTX1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DUSP15 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct EDC4 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct EFS Far Western, peptide array physical, physical association 17474147 , 8647432 , (Europe PMC )0.40 BioGRID, IntAct EGFR Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, PCA, Protein-peptide, Two-hybrid, luminescence based mammalian interactome mapping, protein array, ubiquitin reconstruction direct interaction, physical, physical association 10595738 , 16273093 , 16729043 , 24658140 , 25402006 , 9617486 , 9642287 , (Europe PMC )0.51, 0.59 BioGRID, IntAct, MINT ELK1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct ELK3 bimolecular fluorescence complementation, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 26871637 , (Europe PMC )0.60 IntAct EPB41L3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct EPS15 Affinity Capture-MS, Far Western, Reconstituted Complex, tandem affinity purification association, physical 19380743 , 7797522 , (Europe PMC )0.35 BioGRID, IntAct EPYC Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct ERBB2 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT ERBB3 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT ESD Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct EXTL3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct EYA3 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct F2RL2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct FANCA peptide array physical association 17474147 , (Europe PMC )0.40 IntAct FASLG Protein-peptide, phage display direct interaction, physical 19807924 , (Europe PMC )0.44 BioGRID, IntAct FASTK peptide array physical association 17474147 , (Europe PMC )0.40 IntAct FCGR2B peptide array physical association 17474147 , (Europe PMC )0.40 IntAct FCGR2C peptide array physical association 17474147 , (Europe PMC )0.40 IntAct FER Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct FGFR1 Affinity Capture-Western, Co-localization, Reconstituted Complex, affinity chromatography technology, proximity ligation assay association, physical, physical association 10464310 , 25241761 , (Europe PMC )0.56 BioGRID, IntAct, MINT FLNA Co-localization, peptide array, proximity ligation assay physical, physical association 17474147 , 25241761 , (Europe PMC )0.59 BioGRID, IntAct FLNB peptide array physical association 17474147 , (Europe PMC )0.40 IntAct FLNC peptide array physical association 17474147 , (Europe PMC )0.40 IntAct FLT1 proximity ligation assay physical association 23397142 , (Europe PMC )0.40 IntAct FSTL1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct FYB1 pull down association 22074159 , (Europe PMC )0.35 IntAct GAB1 Affinity Capture-MS, fluorescence polarization spectroscopy direct interaction, physical 19380743 , 24728074 , (Europe PMC )0.44 BioGRID, IntAct GABBR1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct GABPB2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct GAREM1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct GCFC2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct GHR peptide array physical association 17474147 , (Europe PMC )0.40 IntAct GP9 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct GRB2 Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, tandem affinity purification association, physical 10962563 , 10970810 , 19380743 , 8662907 , 8810325 , (Europe PMC )0.35 BioGRID, IntAct GRIN2D peptide array physical association 17474147 , (Europe PMC )0.40 IntAct GRIP2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct HABP4 two hybrid array physical association 25814554 , (Europe PMC )0.37 IntAct HEXA peptide array physical association 17474147 , (Europe PMC )0.40 IntAct HIST1H1E anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct HLA-B anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct HNRNPR peptide array physical association 17474147 , (Europe PMC )0.40 IntAct HSH2D Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct ID4 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct IFT140 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct IGF1R two hybrid physical association 15522217 , (Europe PMC )0.37 IntAct IKZF3 barcode fusion genetics two hybrid, validated two hybrid physical association 27107012 , (Europe PMC )0.49 IntAct INF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct INO80E Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct INPPL1 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct INSR two hybrid physical association 15522217 , (Europe PMC )0.37 IntAct IRS4 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down association, physical 11316748 , 9614078 , (Europe PMC )0.46 BioGRID, IntAct, MINT ISG20L2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct ISL1 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct KAT6A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KCTD13 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct KCTD17 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct KDR proximity ligation assay physical association 23397142 , (Europe PMC )0.40 IntAct KHDRBS1 pull down physical association 11278465 , 7537265 , (Europe PMC )0.40 IntAct KIF22 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct KIT Two-hybrid, fluorescence polarization spectroscopy, pull down association, direct interaction, physical 12878163 , 24728074 , 9233773 , (Europe PMC )0.59 BioGRID, IntAct, MINT KLF15 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct KMT2B peptide array physical association 17474147 , (Europe PMC )0.40 IntAct LASP1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct LCOR anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct LHX8 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct LIG3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct LNX2 barcode fusion genetics two hybrid, validated two hybrid physical association 27107012 , (Europe PMC )0.49 IntAct MAGEC3 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct MAP4K1 Affinity Capture-Western, Reconstituted Complex, peptide array, pull down physical, physical association 11279207 , 17474147 , 9788432 , 9891069 , (Europe PMC )0.59 BioGRID, IntAct MAP4K5 Affinity Capture-MS, Affinity Capture-Western, coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 10648385 , 19380743 , 9788432 , (Europe PMC )0.64 BioGRID, IntAct MAPK4 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MAPK8 Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay, pull down physical, physical association 11432831 , 16982329 , 25241761 , (Europe PMC )0.59 BioGRID, IntAct, MINT MEPE peptide array physical association 17474147 , (Europe PMC )0.40 IntAct MET Affinity Capture-Western, fluorescence polarization spectroscopy direct interaction, physical 24728074 , 24828152 , (Europe PMC )0.44 BioGRID, IntAct MNDA Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct MPDZ Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MPG Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct MRPL48 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYLIP Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct MYO18B peptide array physical association 17474147 , (Europe PMC )0.40 IntAct MYOZ2 two hybrid array, validated two hybrid physical association 25814554 , (Europe PMC )0.49 IntAct NFASC peptide array physical association 17474147 , (Europe PMC )0.40 IntAct NKX2-1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct NR5A1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct NUFIP2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct NUMA1 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct NXPH3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct ODF2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct OFCC1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct OGN peptide array physical association 17474147 , (Europe PMC )0.40 IntAct OPTC peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PAFAH1B2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PAG1 anti bait coimmunoprecipitation association 18070987 , (Europe PMC )0.35 IntAct, MINT PAX7 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA10 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA11 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA12 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA5 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA6 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA7 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA8 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA9 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PDGFRA Affinity Capture-Western, Co-localization, Reconstituted Complex, coimmunoprecipitation, enzymatic study, proximity ligation assay, pull down association, physical, physical association 10733900 , 25241761 , 9546424 , (Europe PMC )0.71 BioGRID, IntAct, MINT PDGFRB Affinity Capture-Western, Reconstituted Complex, pull down association, physical 10733900 , (Europe PMC )0.35 BioGRID, IntAct, MINT PDIA2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PEAK1 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 19380743 , 20534451 , (Europe PMC )0.35 BioGRID, IntAct PHACTR2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PHC2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PIK3R1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Two-hybrid, proximity ligation assay, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 10962563 , 11418612 , 19380743 , 25241761 , 25814554 , (Europe PMC )0.49, 0.56 BioGRID, IntAct PIK3R2 Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 19380743 , 25814554 , (Europe PMC )0.35, 0.49 BioGRID, IntAct PIK3R3 Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 19380743 , 25814554 , (Europe PMC )0.49, 0.62 BioGRID, IntAct PLSCR1 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct PNMA2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct POT1 Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct PPFIBP2 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 19447967 , 26871637 , (Europe PMC )0.67 BioGRID, IntAct PPIA fluorescent resonance energy transfer, isothermal titration calorimetry, nuclear magnetic resonance direct interaction, physical association 26656091 , (Europe PMC )0.61 IntAct PPP1CA Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PPP1R12A anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct PRICKLE3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PRKACA Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PRRC2B Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct PRRG2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PRX peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PSMC1 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct PSMC6 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 26871637 , (Europe PMC )0.76 BioGRID, IntAct PTK2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array, validated two hybrid physical, physical association 10085298 , 12615911 , 25814554 , 7561682 , (Europe PMC )0.63 BioGRID, IntAct PTPN4 Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, confocal microscopy, two hybrid colocalization, physical, physical association 21988832 , (Europe PMC )0.54 BioGRID, IntAct PTTG1 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct PXN Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 10085298 , 12198159 , 12799422 , 26656091 , (Europe PMC )0.40 BioGRID, IntAct, MINT RAB2B Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct RAG1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct RAPGEF1 Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, coimmunoprecipitation, peptide array, pull down, tandem affinity purification association, physical, physical association 10464310 , 17474147 , 17515907 , 18835194 , 19380743 , 7512734 , 7531694 , 8621483 , 8943292 , (Europe PMC )0.35, 0.69 BioGRID, IntAct, MINT RET Co-localization, Reconstituted Complex, proximity ligation assay physical, physical association 25241761 , 9393871 , (Europe PMC )0.40 BioGRID, IntAct RGS20 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct RGS7 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct RIN3 Two-hybrid, peptide array, two hybrid array physical, physical association 17474147 , 25814554 , (Europe PMC )0.57 BioGRID, IntAct RPP38 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct RRAS peptide array physical association 17474147 , (Europe PMC )0.40 IntAct RTCB two hybrid array, validated two hybrid physical association 25814554 , (Europe PMC )0.49 IntAct RYBP Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct SAXO1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SEMA4D Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct SEPT6 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct SETD9 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct SH2D2A Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct SHANK2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SHANK3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SHC1 Affinity Capture-MS, Affinity Capture-Western, proximity ligation assay, tandem affinity purification association, physical, physical association 10464310 , 19380743 , 23397142 , 9617486 , (Europe PMC )0.56 BioGRID, IntAct SLC25A13 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SNX17 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SNX3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SNX7 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SOCS1 Reconstituted Complex, Two-hybrid, two hybrid array, validated two hybrid physical, physical association 10022833 , 25814554 , (Europe PMC )0.49 BioGRID, IntAct SOCS6 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct SOS1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, peptide array, proximity ligation assay, tandem affinity purification association, physical, physical association 17474147 , 19380743 , 25241761 , 8810325 , 8943292 , (Europe PMC )0.69 BioGRID, IntAct SOS2 Affinity Capture-MS, peptide array, tandem affinity purification association, physical, physical association 17474147 , 19380743 , (Europe PMC )0.56 BioGRID, IntAct SP1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SPEN peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SPRR2A Reconstituted Complex, protein array direct interaction, physical 18155796 , (Europe PMC )0.44 BioGRID, IntAct, MINT SRC Affinity Capture-Western, proximity ligation assay physical, physical association 10962563 , 12615911 , 23397142 , (Europe PMC )0.40 BioGRID, IntAct STAT4 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct STAT5A Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct STRN4 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct SUV39H2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct TAL1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct TCAP Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct TDG Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct TERF2IP Two-hybrid, bimolecular fluorescence complementation, pull down physical, physical association 21044950 , (Europe PMC )0.51 BioGRID, IntAct TGOLN2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct THOC2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct TM4SF19 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct TNK2 anti bait coimmunoprecipitation physical association 17038317 , (Europe PMC )0.40 IntAct, MINT TP53 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct TP53BP2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct TPX2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct TRIM39 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct TTBK2 tandem affinity purification association 19380743 , (Europe PMC )0.35 IntAct TUBA1C Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct TWIST2 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct UBASH3A Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct UBASH3B Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct USP53 barcode fusion genetics two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 26871637 , 27107012 , (Europe PMC )0.78 IntAct VAC14 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct VAV1 coimmunoprecipitation physical association 8621483 , (Europe PMC )0.40 IntAct, MINT WASL coimmunoprecipitation physical association 15834156 , (Europe PMC )0.40 IntAct, MINT WDR83 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct ZAP70 Reconstituted Complex, pull down association, physical 10419455 , 16339550 , (Europe PMC )0.35 BioGRID, IntAct, MINT ZKSCAN7 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct ZNF557 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABI1 array technology direct interaction 20598684 , (Europe PMC )0.44 IntAct, MINT ABL1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, nuclear magnetic resonance, peptide array, protein kinase assay, pull down association, phosphorylation reaction, physical, physical association 12097319 , 12384576 , 15696159 , 17474147 , 17515907 , 18619508 , 18835194 , 19380743 , 24412932 , 8194526 , 9747873 , (Europe PMC )0.35, 0.44, 0.56 BioGRID, IntAct, MINT BCAR1 Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10085298 , 10329689 , 10464310 , 10747099 , 10753828 , 11278916 , 11369773 , 11839772 , 12615911 , 12799422 , 14657239 , 15492270 , 15673687 , 16267043 , 17038317 , 18835194 , 19380743 , 22974441 , 9581808 , 9920935 , (Europe PMC )0.76 BioGRID, IntAct, MINT CBL Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 10962563 , 11792427 , 12393469 , 15581361 , 16289966 , 18835194 , 19380743 , 22974441 , 25814554 , 8524328 , 8621483 , 8626404 , 8626543 , 8662998 , 8683103 , 8943292 , 9129019 , 9178909 , 9416834 , 9461587 , 9617486 , 9988765 , (Europe PMC )0.49, 0.88 BioGRID, IntAct, MINT EGFR Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, PCA, Protein-peptide, Two-hybrid, luminescence based mammalian interactome mapping, protein array, ubiquitin reconstruction direct interaction, physical, physical association 10595738 , 16273093 , 16729043 , 24658140 , 25402006 , 9617486 , 9642287 , (Europe PMC )0.51, 0.59 BioGRID, IntAct, MINT ERBB2 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT ERBB3 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT FGFR1 Affinity Capture-Western, Co-localization, Reconstituted Complex, affinity chromatography technology, proximity ligation assay association, physical, physical association 10464310 , 25241761 , (Europe PMC )0.56 BioGRID, IntAct, MINT IRS4 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down association, physical 11316748 , 9614078 , (Europe PMC )0.46 BioGRID, IntAct, MINT KIT Two-hybrid, fluorescence polarization spectroscopy, pull down association, direct interaction, physical 12878163 , 24728074 , 9233773 , (Europe PMC )0.59 BioGRID, IntAct, MINT MAPK8 Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay, pull down physical, physical association 11432831 , 16982329 , 25241761 , (Europe PMC )0.59 BioGRID, IntAct, MINT PAG1 anti bait coimmunoprecipitation association 18070987 , (Europe PMC )0.35 IntAct, MINT PDGFRA Affinity Capture-Western, Co-localization, Reconstituted Complex, coimmunoprecipitation, enzymatic study, proximity ligation assay, pull down association, physical, physical association 10733900 , 25241761 , 9546424 , (Europe PMC )0.71 BioGRID, IntAct, MINT PDGFRB Affinity Capture-Western, Reconstituted Complex, pull down association, physical 10733900 , (Europe PMC )0.35 BioGRID, IntAct, MINT PXN Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 10085298 , 12198159 , 12799422 , 26656091 , (Europe PMC )0.40 BioGRID, IntAct, MINT RAPGEF1 Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, coimmunoprecipitation, peptide array, pull down, tandem affinity purification association, physical, physical association 10464310 , 17474147 , 17515907 , 18835194 , 19380743 , 7512734 , 7531694 , 8621483 , 8943292 , (Europe PMC )0.35, 0.69 BioGRID, IntAct, MINT SPRR2A Reconstituted Complex, protein array direct interaction, physical 18155796 , (Europe PMC )0.44 BioGRID, IntAct, MINT TNK2 anti bait coimmunoprecipitation physical association 17038317 , (Europe PMC )0.40 IntAct, MINT VAV1 coimmunoprecipitation physical association 8621483 , (Europe PMC )0.40 IntAct, MINT WASL coimmunoprecipitation physical association 15834156 , (Europe PMC )0.40 IntAct, MINT ZAP70 Reconstituted Complex, pull down association, physical 10419455 , 16339550 , (Europe PMC )0.35 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABAT peptide array physical association 17474147 , (Europe PMC )0.40 IntAct ABI1 array technology direct interaction 20598684 , (Europe PMC )0.44 IntAct, MINT ABL1 Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, nuclear magnetic resonance, peptide array, protein kinase assay, pull down association, phosphorylation reaction, physical, physical association 12097319 , 12384576 , 15696159 , 17474147 , 17515907 , 18619508 , 18835194 , 19380743 , 24412932 , 8194526 , 9747873 , (Europe PMC )0.35, 0.44, 0.56 BioGRID, IntAct, MINT ABL2 Affinity Capture-MS, Biochemical Activity, Reconstituted Complex, Two-hybrid, peptide array, protein kinase assay, tandem affinity purification, two hybrid array, validated two hybrid association, phosphorylation reaction, physical, physical association 15886098 , 17474147 , 19380743 , 25814554 , 8194526 , (Europe PMC )0.49, 0.70 BioGRID, IntAct ACTB Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID AFF2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct AGO1 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct AGO2 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct AGPAT4 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct AIRE peptide array physical association 17474147 , (Europe PMC )0.40 IntAct AKAP2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct AKAP6 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct ALS2CR12 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 26871637 , (Europe PMC )0.56 IntAct ANKZF1 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct ANLN Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct AP2A1 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct AP2B1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID AP2M1 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct APOL5 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct AR fluorescence polarization spectroscopy direct interaction 24728074 , (Europe PMC )0.44 IntAct ARHGAP17 Reconstituted Complex physical 11431473 , (Europe PMC )NA BioGRID ARHGAP32 Affinity Capture-Western, Reconstituted Complex physical 12454018 , 12819203 , (Europe PMC )NA BioGRID ARHGEF11 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct ARPC1B Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct ASAP1 Affinity Capture-MS, Reconstituted Complex, peptide array physical, physical association 17474147 , 19380743 , 9819391 , (Europe PMC )0.40 BioGRID, IntAct ASAP2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct ASAP3 Affinity Capture-MS, bimolecular fluorescence complementation, tandem affinity purification, two hybrid array, two hybrid prey pooling approach, validated two hybrid association, physical, physical association 19380743 , 26871637 , (Europe PMC )0.70 BioGRID, IntAct ASB9 Affinity Capture-Luminescence, Two-hybrid, luminescence based mammalian interactome mapping, two hybrid array physical, physical association 25814554 , (Europe PMC )0.51 BioGRID, IntAct ASCL4 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct ATF3 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct ATIC Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID ATXN1 Affinity Capture-Western, Two-hybrid, pull down, two hybrid array, two hybrid prey pooling approach physical, physical association 16713569 , 23275563 , (Europe PMC )0.63 BioGRID, IntAct AVIL Reconstituted Complex physical 11287316 , (Europe PMC )NA BioGRID BAG3 Affinity Capture-Luminescence, Affinity Capture-MS physical 23824909 , (Europe PMC )NA BioGRID BATF3 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct BCAR1 Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10085298 , 10329689 , 10464310 , 10747099 , 10753828 , 11278916 , 11369773 , 11839772 , 12615911 , 12799422 , 14657239 , 15492270 , 15673687 , 16267043 , 17038317 , 18835194 , 19380743 , 22974441 , 9581808 , 9920935 , (Europe PMC )0.76 BioGRID, IntAct, MINT BCR Affinity Capture-MS, Reconstituted Complex physical 19380743 , 8943292 , (Europe PMC )NA BioGRID BEX5 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct BICRA peptide array physical association 17474147 , (Europe PMC )0.40 IntAct BMX peptide array physical association 17474147 , (Europe PMC )0.40 IntAct BRD4 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct BUB1 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct C1orf94 two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 26871637 , (Europe PMC )0.56 IntAct C4orf17 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct C6orf141 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct CASS4 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct CAST Co-fractionation, peptide array physical, physical association 17474147 , 26344197 , (Europe PMC )0.40 BioGRID, IntAct CBL Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, coimmunoprecipitation, pull down, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 10962563 , 11792427 , 12393469 , 15581361 , 16289966 , 18835194 , 19380743 , 22974441 , 25814554 , 8524328 , 8621483 , 8626404 , 8626543 , 8662998 , 8683103 , 8943292 , 9129019 , 9178909 , 9416834 , 9461587 , 9617486 , 9988765 , (Europe PMC )0.49, 0.88 BioGRID, IntAct, MINT CBLB Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 19380743 , 25814554 , (Europe PMC )0.49, 0.62 BioGRID, IntAct CBLC Reconstituted Complex, Two-hybrid, two hybrid array, validated two hybrid physical, physical association 10362357 , 25814554 , (Europe PMC )0.49 BioGRID, IntAct CCP110 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CD93 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct CDH1 Proximity Label-MS physical 25468996 , (Europe PMC )NA BioGRID CDH11 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct CELSR2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct CEP128 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CEP19 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CEP89 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CHTF18 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct CLNK Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct CNDP2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct CNTFR peptide array physical association 17474147 , (Europe PMC )0.40 IntAct CNTNAP1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct CORO1C Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID CORO6 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct COX6C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CSE1L Affinity Capture-Western physical 8943292 , (Europe PMC )NA BioGRID CSMD2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DDX3X Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID DDX41 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DDX5 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID DDX6 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct DHX9 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID DKKL1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DLGAP1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DLGAP2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DLGAP3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DLGAP4 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DLX4 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DNAJA3 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID DNM2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DOCK1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex, peptide array, pull down association, physical, physical association 10559471 , 11369773 , 12615911 , 15673687 , 17474147 , 17515907 , 26344197 , 8657152 , 8662907 , (Europe PMC )0.35, 0.40 BioGRID, IntAct DOCK3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DOK1 Protein-peptide physical 22974441 , (Europe PMC )NA BioGRID DOK2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct DOK3 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct DOK7 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct DPPA4 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 26871637 , (Europe PMC )0.67 BioGRID, IntAct DSC1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID DTX1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct DUSP15 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct EDC4 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct EEF1A1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID EFS Far Western, peptide array physical, physical association 17474147 , 8647432 , (Europe PMC )0.40 BioGRID, IntAct EGFR Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Biochemical Activity, PCA, Protein-peptide, Two-hybrid, luminescence based mammalian interactome mapping, protein array, ubiquitin reconstruction direct interaction, physical, physical association 10595738 , 16273093 , 16729043 , 24658140 , 25402006 , 9617486 , 9642287 , (Europe PMC )0.51, 0.59 BioGRID, IntAct, MINT ELK1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct ELK3 bimolecular fluorescence complementation, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 26871637 , (Europe PMC )0.60 IntAct EPB41L3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct EPHA3 Affinity Capture-Western physical 11870224 , (Europe PMC )NA BioGRID EPHB2 Reconstituted Complex physical 10644995 , (Europe PMC )NA BioGRID EPHB3 Reconstituted Complex physical 9674711 , (Europe PMC )NA BioGRID EPS15 Affinity Capture-MS, Far Western, Reconstituted Complex, tandem affinity purification association, physical 19380743 , 7797522 , (Europe PMC )0.35 BioGRID, IntAct EPYC Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct ERBB2 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT ERBB3 Protein-peptide, protein array direct interaction, physical 16273093 , (Europe PMC )0.44 BioGRID, IntAct, MINT ERBB4 Affinity Capture-MS physical 16729043 , (Europe PMC )NA BioGRID ESD Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct EXTL3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct EYA3 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct F2RL2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct FANCA peptide array physical association 17474147 , (Europe PMC )0.40 IntAct FASLG Protein-peptide, phage display direct interaction, physical 19807924 , (Europe PMC )0.44 BioGRID, IntAct FASTK peptide array physical association 17474147 , (Europe PMC )0.40 IntAct FCGR2B peptide array physical association 17474147 , (Europe PMC )0.40 IntAct FCGR2C peptide array physical association 17474147 , (Europe PMC )0.40 IntAct FER Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct FGFR1 Affinity Capture-Western, Co-localization, Reconstituted Complex, affinity chromatography technology, proximity ligation assay association, physical, physical association 10464310 , 25241761 , (Europe PMC )0.56 BioGRID, IntAct, MINT FLNA Co-localization, peptide array, proximity ligation assay physical, physical association 17474147 , 25241761 , (Europe PMC )0.59 BioGRID, IntAct FLNB peptide array physical association 17474147 , (Europe PMC )0.40 IntAct FLNC peptide array physical association 17474147 , (Europe PMC )0.40 IntAct FLT1 proximity ligation assay physical association 23397142 , (Europe PMC )0.40 IntAct FRS2 Reconstituted Complex physical 10092678 , (Europe PMC )NA BioGRID FSTL1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct FUBP1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID FYB1 pull down association 22074159 , (Europe PMC )0.35 IntAct GAB1 Affinity Capture-MS, fluorescence polarization spectroscopy direct interaction, physical 19380743 , 24728074 , (Europe PMC )0.44 BioGRID, IntAct GAB2 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID GABBR1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct GABPB2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct GAREM1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct GCFC2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct GFPT1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID GGA3 Affinity Capture-Western physical 21664574 , (Europe PMC )NA BioGRID GHR peptide array physical association 17474147 , (Europe PMC )0.40 IntAct GP9 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct GRB2 Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, tandem affinity purification association, physical 10962563 , 10970810 , 19380743 , 8662907 , 8810325 , (Europe PMC )0.35 BioGRID, IntAct GRIN2D peptide array physical association 17474147 , (Europe PMC )0.40 IntAct GRIP2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct HABP4 Two-hybrid physical 25814554 , (Europe PMC )NA BioGRID HABP4 two hybrid array physical association 25814554 , (Europe PMC )0.37 IntAct HEXA peptide array physical association 17474147 , (Europe PMC )0.40 IntAct HIST1H1D Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID HIST1H1E anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct HLA-B anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct HNRNPR peptide array physical association 17474147 , (Europe PMC )0.40 IntAct HSH2D Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct HSP90AB1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HSPA1B Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HSPA1L Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HSPA5 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HSPA6 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HSPA9 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HSPB1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID HSPBP1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID HUWE1 Affinity Capture-MS physical 25147182 , (Europe PMC )NA BioGRID ID4 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct IFT140 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct IGF1R two hybrid physical association 15522217 , (Europe PMC )0.37 IntAct IKZF3 barcode fusion genetics two hybrid, validated two hybrid physical association 27107012 , (Europe PMC )0.49 IntAct INF2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct INO80E Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct INPPL1 Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct INSR two hybrid physical association 15522217 , (Europe PMC )0.37 IntAct IRS4 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, pull down association, physical 11316748 , 9614078 , (Europe PMC )0.46 BioGRID, IntAct, MINT ISG20L2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct ISL1 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct KAT6A Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct KCTD13 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct KCTD17 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct KDR proximity ligation assay physical association 23397142 , (Europe PMC )0.40 IntAct KHDRBS1 Reconstituted Complex physical 1545818 , (Europe PMC )NA BioGRID KHDRBS1 pull down physical association 11278465 , 7537265 , (Europe PMC )0.40 IntAct KIF22 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct KIT Two-hybrid, fluorescence polarization spectroscopy, pull down association, direct interaction, physical 12878163 , 24728074 , 9233773 , (Europe PMC )0.59 BioGRID, IntAct, MINT KLF15 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct KLHL20 Two-hybrid physical 25814554 , (Europe PMC )NA BioGRID KMT2B peptide array physical association 17474147 , (Europe PMC )0.40 IntAct KRT1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT10 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT12 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT14 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT15 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT16 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT17 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT19 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT2 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT24 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT3 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT4 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT5 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT6A Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT6B Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT73 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT76 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT77 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT78 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT79 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT8 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID KRT9 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID LASP1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct LCOR anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct LHX8 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct LIG3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct LMNA Proximity Label-MS physical 22412018 , (Europe PMC )NA BioGRID LNX2 barcode fusion genetics two hybrid, validated two hybrid physical association 27107012 , (Europe PMC )0.49 IntAct LYZ Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID MAGEC3 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct MAP4K1 Affinity Capture-Western, Reconstituted Complex, peptide array, pull down physical, physical association 11279207 , 17474147 , 9788432 , 9891069 , (Europe PMC )0.59 BioGRID, IntAct MAP4K5 Affinity Capture-MS, Affinity Capture-Western, coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 10648385 , 19380743 , 9788432 , (Europe PMC )0.64 BioGRID, IntAct MAPK4 Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct MAPK8 Affinity Capture-Western, Co-localization, Reconstituted Complex, proximity ligation assay, pull down physical, physical association 11432831 , 16982329 , 25241761 , (Europe PMC )0.59 BioGRID, IntAct, MINT MEPE peptide array physical association 17474147 , (Europe PMC )0.40 IntAct MET Affinity Capture-Western, fluorescence polarization spectroscopy direct interaction, physical 24728074 , 24828152 , (Europe PMC )0.44 BioGRID, IntAct MICAL1 Reconstituted Complex physical 11827972 , (Europe PMC )NA BioGRID MNDA Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct MPDZ Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MPG Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct MRPL48 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MYLIP Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct MYO18B peptide array physical association 17474147 , (Europe PMC )0.40 IntAct MYOZ2 Two-hybrid physical 25814554 , (Europe PMC )NA BioGRID MYOZ2 two hybrid array, validated two hybrid physical association 25814554 , (Europe PMC )0.49 IntAct NANS Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID NCKIPSD Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID NEDD9 Affinity Capture-Western, Reconstituted Complex physical 8879209 , 9295052 , 9497377 , (Europe PMC )NA BioGRID NFASC peptide array physical association 17474147 , (Europe PMC )0.40 IntAct NKX2-1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct NR5A1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct NUFIP2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct NUMA1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID NUMA1 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct NXPH3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct ODF2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct OFCC1 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct OGN peptide array physical association 17474147 , (Europe PMC )0.40 IntAct OPTC peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PAFAH1B2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PAG1 anti bait coimmunoprecipitation association 18070987 , (Europe PMC )0.35 IntAct, MINT PAX7 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA10 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA11 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA12 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA5 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA6 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA7 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA8 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PCDHA9 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PDGFRA Affinity Capture-Western, Co-localization, Reconstituted Complex, coimmunoprecipitation, enzymatic study, proximity ligation assay, pull down association, physical, physical association 10733900 , 25241761 , 9546424 , (Europe PMC )0.71 BioGRID, IntAct, MINT PDGFRB Affinity Capture-Western, Reconstituted Complex, pull down association, physical 10733900 , (Europe PMC )0.35 BioGRID, IntAct, MINT PDIA2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PEAK1 Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 19380743 , 20534451 , (Europe PMC )0.35 BioGRID, IntAct PHACTR2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PHC2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PIK3C2B Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID PIK3CA Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID PIK3CB Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID PIK3CD Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID PIK3R1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Two-hybrid, proximity ligation assay, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 10962563 , 11418612 , 19380743 , 25241761 , 25814554 , (Europe PMC )0.49, 0.56 BioGRID, IntAct PIK3R2 Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 19380743 , 25814554 , (Europe PMC )0.35, 0.49 BioGRID, IntAct PIK3R3 Affinity Capture-MS, Two-hybrid, tandem affinity purification, two hybrid array, validated two hybrid association, physical, physical association 19380743 , 25814554 , (Europe PMC )0.49, 0.62 BioGRID, IntAct PLSCR1 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct PNMA2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct POT1 Two-hybrid, bimolecular fluorescence complementation physical, physical association 21044950 , (Europe PMC )0.37 BioGRID, IntAct PPFIBP2 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 19447967 , 26871637 , (Europe PMC )0.67 BioGRID, IntAct PPIA fluorescent resonance energy transfer, isothermal titration calorimetry, nuclear magnetic resonance direct interaction, physical association 26656091 , (Europe PMC )0.61 IntAct PPP1CA Two-hybrid, two hybrid physical, physical association 22321011 , (Europe PMC )0.37 BioGRID, IntAct PPP1R12A Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID PPP1R12A anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct PRICKLE3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PRKACA Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PRRC2B Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct PRRG2 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct PRX peptide array physical association 17474147 , (Europe PMC )0.40 IntAct PSMC1 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct PSMC6 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 26871637 , (Europe PMC )0.76 BioGRID, IntAct PTK2 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array, validated two hybrid physical, physical association 10085298 , 12615911 , 25814554 , 7561682 , (Europe PMC )0.63 BioGRID, IntAct PTPN1 Reconstituted Complex physical 8940134 , (Europe PMC )NA BioGRID PTPN11 Affinity Capture-MS, Affinity Capture-Western physical 10464310 , 19380743 , (Europe PMC )NA BioGRID PTPN4 Affinity Capture-Western, Two-hybrid, anti tag coimmunoprecipitation, confocal microscopy, two hybrid colocalization, physical, physical association 21988832 , (Europe PMC )0.54 BioGRID, IntAct PTTG1 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct PXN Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 10085298 , 12198159 , 12799422 , 26656091 , (Europe PMC )0.40 BioGRID, IntAct, MINT RAB2B Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct RAG1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct RAPGEF1 Affinity Capture-MS, Affinity Capture-Western, Far Western, Reconstituted Complex, coimmunoprecipitation, peptide array, pull down, tandem affinity purification association, physical, physical association 10464310 , 17474147 , 17515907 , 18835194 , 19380743 , 7512734 , 7531694 , 8621483 , 8943292 , (Europe PMC )0.35, 0.69 BioGRID, IntAct, MINT RET Co-localization, Reconstituted Complex, proximity ligation assay physical, physical association 25241761 , 9393871 , (Europe PMC )0.40 BioGRID, IntAct RGS20 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct RGS7 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct RIN3 Two-hybrid, peptide array, two hybrid array physical, physical association 17474147 , 25814554 , (Europe PMC )0.57 BioGRID, IntAct RNGTT Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID RPL23 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID RPP38 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct RPS19 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID RPS25 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID RPS3 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID RPS5 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID RRAS peptide array physical association 17474147 , (Europe PMC )0.40 IntAct RTCB Two-hybrid physical 25814554 , (Europe PMC )NA BioGRID RTCB two hybrid array, validated two hybrid physical association 25814554 , (Europe PMC )0.49 IntAct RYBP Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct SAXO1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct SEMA4D Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct SEPT6 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct SERPINB6 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID SERPINH1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SETD9 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct SFN Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID SH2D2A Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct SH3BP1 Reconstituted Complex physical 1379745 , (Europe PMC )NA BioGRID SH3KBP1 Affinity Capture-Western physical 11071869 , (Europe PMC )NA BioGRID SHANK2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SHANK3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SHB Affinity Capture-Western physical 10964504 , (Europe PMC )NA BioGRID SHC1 Affinity Capture-MS, Affinity Capture-Western, proximity ligation assay, tandem affinity purification association, physical, physical association 10464310 , 19380743 , 23397142 , 9617486 , (Europe PMC )0.56 BioGRID, IntAct SLC25A13 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct SNX17 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SNX3 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SNX7 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SOCS1 Reconstituted Complex, Two-hybrid, two hybrid array, validated two hybrid physical, physical association 10022833 , 25814554 , (Europe PMC )0.49 BioGRID, IntAct SOCS6 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct SOS1 Affinity Capture-MS, Affinity Capture-Western, Co-localization, Reconstituted Complex, peptide array, proximity ligation assay, tandem affinity purification association, physical, physical association 17474147 , 19380743 , 25241761 , 8810325 , 8943292 , (Europe PMC )0.69 BioGRID, IntAct SOS2 Affinity Capture-MS, peptide array, tandem affinity purification association, physical, physical association 17474147 , 19380743 , (Europe PMC )0.56 BioGRID, IntAct SP1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SPEN peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SPR Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SPRR2A Reconstituted Complex, protein array direct interaction, physical 18155796 , (Europe PMC )0.44 BioGRID, IntAct, MINT SRC Affinity Capture-Western, proximity ligation assay physical, physical association 10962563 , 12615911 , 23397142 , (Europe PMC )0.40 BioGRID, IntAct SRCIN1 Affinity Capture-Western physical 14657239 , (Europe PMC )NA BioGRID SRM Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STAT4 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct STAT5A Co-localization, proximity ligation assay physical, physical association 25241761 , (Europe PMC )0.40 BioGRID, IntAct STRN4 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct SUV39H2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct SYN1 Affinity Capture-Western physical 10899172 , (Europe PMC )NA BioGRID TAL1 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct TCAP Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct TDG Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct TERF2IP Two-hybrid, bimolecular fluorescence complementation, pull down physical, physical association 21044950 , (Europe PMC )0.51 BioGRID, IntAct TGOLN2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct THOC2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct TM4SF19 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct TNK2 anti bait coimmunoprecipitation physical association 17038317 , (Europe PMC )0.40 IntAct, MINT TP53 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct TP53BP2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct TPX2 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct TRIM15 Affinity Capture-Western, PCA physical 25450970 , (Europe PMC )NA BioGRID TRIM39 peptide array physical association 17474147 , (Europe PMC )0.40 IntAct TSG101 Affinity Capture-Western, Co-localization physical 27764233 , (Europe PMC )NA BioGRID TTBK2 tandem affinity purification association 19380743 , (Europe PMC )0.35 IntAct TUBA1A Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID TUBA1C Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct TUBA4B Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID TUBB Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID TUBB2A Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID TUBB3 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID TUBB4B Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID TWIST2 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct UBASH3A Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct UBASH3B Affinity Capture-MS, tandem affinity purification association, physical 19380743 , (Europe PMC )0.35 BioGRID, IntAct UBC Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID USP53 barcode fusion genetics two hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical association 26871637 , 27107012 , (Europe PMC )0.78 IntAct VAC14 Two-hybrid, two hybrid array, validated two hybrid physical, physical association 25814554 , (Europe PMC )0.49 BioGRID, IntAct VAV1 coimmunoprecipitation physical association 8621483 , (Europe PMC )0.40 IntAct, MINT WASL coimmunoprecipitation physical association 15834156 , (Europe PMC )0.40 IntAct, MINT WDR83 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct WEE1 Affinity Capture-Western physical 11839808 , (Europe PMC )NA BioGRID XPO1 Two-hybrid physical 11839808 , (Europe PMC )NA BioGRID YWHAG Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID YWHAQ Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID ZAP70 Reconstituted Complex, pull down association, physical 10419455 , 16339550 , (Europe PMC )0.35 BioGRID, IntAct, MINT ZKSCAN7 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct ZNF557 Two-hybrid, two hybrid array physical, physical association 25814554 , (Europe PMC )0.37 BioGRID, IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
ABL1 Y221_GGPEPGPyAQPSVNT , Y239_NLQNGPIyARVIQKR , Y251_QKRVPNAyDKTALAL , in vitro, in vivo 11956190 , 12198159 , 17016520 , 20068231 , 8875975 , 9480911 , 9642287 ,(Europe PMC )HPRD, PhosphoSitePlus , ABL2 Y221_GGPEPGPyAQPSVNT , in vitro, in vivo 11956190 , 12198159 , 17016520 , 20068231 , 8875975 , 9480911 , 9642287 ,(Europe PMC )HPRD, PhosphoSitePlus , Abl Y221_GGPEPGPyAQPSVNT , LTP 8194526 ,(Europe PMC )PhosphoELM , EGFR Y221_GGPEPGPyAQPSVNT , in vitro, in vivo 11956190 , 12198159 , 17016520 , 20068231 , 8875975 , 9480911 , 9642287 ,(Europe PMC )HPRD, IGF1R Y221_GGPEPGPyAQPSVNT , in vitro, in vivo 11956190 , 12198159 , 17016520 , 20068231 , 8875975 , 9480911 , 9642287 ,(Europe PMC )HPRD, PAK1 S41_VFLVRDSsTSPGDYV , NA NA PhosphoSitePlus , Unknown S125_VSRSRQGsGVILRQE , S194_VEKYRPAsASVSALI , S196_KYRPASAsVSALIGG , S304_QNPDEDFs , S40_GVFLVRDsSTSPGDY , S41_VFLVRDSsTSPGDYV , S74_PRPPVPPsPAQPPPG , S83_AQPPPGVsPSRLRIG , S85_PPPGVSPsRLRIGDQ , T42_FLVRDSStSPGDYVL , Y221_GGPEPGPyAQPSVNT , Y239_NLQNGPIyARVIQKR , HTP, LTP, in vitro, in vivo 12198159 , 15345747 , 15592455 , 18669648 , 19415658 , 19651622 , 20068231 , 20166139 , 9480991 , 9642287 ,(Europe PMC )HPRD, PhosphoELM ,