Top
CDC37
Localization (UniProt annotation) Cytoplasm Function (UniProt annotation) Co-chaperone that binds to numerous kinases and promotestheir interaction with the Hsp90 complex, resulting instabilization and promotion of their activity (PubMed:8666233)Inhibits HSP90AA1 ATPase activity (PubMed:23569206) Catalytic Activity (UniProt annotation) N/A Protein Sequence MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRKVAECQRKLKELEVAEGGKAE
LERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLSKDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIK
HFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTK
IKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDA
ISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPGDPLLEAVPKTGDEKDVSV
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) hsa04151 PI3K-Akt signaling pathway The phosphatidylinositol 3' -kinase(PI3K)-Akt signaling pathway is activated by many types of cellular stimuli or toxic insults and regulates fundamental cellular functions such as transcription, translation, proliferation, growth, and survival. The binding of growth factors to their receptor tyrosine kinase (RTK) or G protein-coupled receptors (GPCR) stimulates class Ia and Ib PI3K isoforms, respectively. PI3K catalyzes the production of phosphatidylinositol-3,4,5-triphosphate (PIP3) at the cell membrane. PIP3 in turn serves as a second messenger that helps to activate Akt. Once active, Akt can control key cellular processes by phosphorylating substrates involved in apoptosis, protein synthesis, metabolism, and cell cycle.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-1227986 Signaling by ERBB2. ERBB2, also known as HER2 or NEU, is a receptor tyrosine kinase (RTK) belonging to the EGFR family. ERBB2 possesses an extracellular domain that does not bind any known ligand, contrary to other EGFR family members, a single transmembrane domain, and an intracellular domain consisting of an active kinase and a C-tail with multiple tyrosine phosphorylation sites. Inactive ERBB2 is associated with a chaperone heat shock protein 90 (HSP90) and its co-chaperone CDC37 (Xu et al. 2001, Citri et al. 2004, Xu et al. 2005). In addition, ERBB2 is associated with ERBB2IP (also known as ERBIN or LAP2), a protein responsible for proper localization of ERBB2. In epithelial cells, ERBB2IP restricts expression of ERBB2 to basolateral plasma membrane regions (Borg et al. 2000).\nERBB2 becomes activated by forming a heterodimer with another ligand-activated EGFR family member, either EGFR, ERBB3 or ERBB4, which is accompanied by dissociation of chaperoning proteins HSP90 and CDC37 (Citri et al. 2004), as well as ERBB2IP (Borg et al. 2000) from ERBB2. ERBB2 heterodimers function to promote cell proliferation, cell survival and differentiation, depending on the cellular context. ERBB2 can also be activated by homodimerization when it is overexpressed, in cancer for example. \nIn cells expressing both ERBB2 and EGFR, EGF stimulation of EGFR leads to formation of both ERBB2:EGFR heterodimers (Wada et al. 1990, Karunagaran et al. 1996) and EGFR homodimers. Heterodimers of ERBB2 and EGFR trans-autophosphorylate on twelve tyrosine residues, six in the C-tail of EGFR and six in the C-tail of ERBB2 - Y1023, Y1139, Y1196, Y1221, Y1222 and Y1248 (Margolis et al. 1989, Hazan et al. 1990,Walton et al. 1990, Helin et al. 1991, Ricci et al. 1995, Pinkas-Kramarski 1996). Phosphorylated tyrosine residues in the C-tail of EGFR and ERBB2 serve as docking sites for downstream signaling molecules. Three key signaling pathways activated by ERBB2:EGFR heterodimers are RAF/MAP kinase cascade, PI3K-induced AKT signaling, and signaling by phospholipase C gamma (PLCG1). Downregulation of EGFR signaling is mediated by ubiquitin ligase CBL, and is shown under Signaling by EGFR.\nIn cells expressing ERBB2 and ERBB3, ERBB3 activated by neuregulin NRG1 or NRG2 binding (Tzahar et al. 1994) forms a heterodimer with ERBB2 (Pinkas-Kramarski et al. 1996, Citri et al. 2004). ERBB3 is the only EGFR family member with no kinase activity, and can only function in heterodimers, with ERBB2 being its preferred heterodimerization partner. After heterodimerization, ERBB2 phosphorylates ten tyrosine residues in the C-tail of ERBB3, Y1054, Y1197, Y1199, Y1222, Y1224, Y1260, Y1262, Y1276, Y1289 and Y1328 (Prigent et al. 1994, Pinkas-Kramarski et al. 1996, Vijapurkar et al. 2003, Li et al. 2007) that subsequently serve as docking sites for downstream signaling molecules, resulting in activation of PI3K-induced AKT signaling and RAF/MAP kinase cascade. Signaling by ERBB3 is downregulated by the action of RNF41 ubiquitin ligase, also known as NRDP1. \nIn cells expressing ERBB2 and ERBB4, ligand stimulated ERBB4 can either homodimerize or form heterodimers with ERBB2 (Li et al. 2007), resulting in trans-autophosphorylation of ERBB2 and ERBB4 on C-tail tyrosine residues that will subsequently serve as docking sites for downstream signaling molecules, leading to activation of RAF/MAP kinase cascade and, in the case of ERBB4 CYT1 isoforms, PI3K-induced AKT signaling (Hazan et al. 1990, Cohen et al. 1996, Li et al. 2007, Kaushansky et al. 2008). Signaling by ERBB4 is downregulated by the action of WWP1 and ITCH ubiquitin ligases, and is shown under Signaling by ERBB4 R-HSA-1236382 Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants. Signaling by EGFR is frequently activated in cancer through activating mutations in the coding sequence of the EGFR gene, resulting in expression of a constitutively active mutant protein. Epidermal growth factor receptor kinase domain mutants are present in ~16% of non-small-cell lung cancers (NSCLCs), but are also found in other cancer types, such as breast cancer, colorectal cancer, ovarian cancer and thyroid cancer. EGFR kinase domain mutants harbor activating mutations in exons 18-21 which code for the kinase domain (amino acids 712-979) . Small deletions, insertions or substitutions of amino acids within the kinase domain lock EGFR in its active conformation in which the enzyme can dimerize and undergo autophosphorylation spontaneously, without ligand binding (although ligand binding ability is preserved), and activate downstream signaling pathways that promote cell survival (Greulich et al. 2005, Zhang et al. 2006, Yun et al. 2007, Red Brewer et al. 2009). Point mutations in the extracellular domain of EGFR are frequently found in glioblastoma. Similar to kinase domain mutations, point mutations in the extracellular domain result in constitutively active EGFR proteins that signal in the absence of ligands, but ligand binding ability and responsiveness are preserved (Lee et al. 2006). EGFR kinase domain mutants need to maintain association with the chaperone heat shock protein 90 (HSP90) for proper functioning (Shimamura et al. 2005, Lavictoire et al. 2003). CDC37 is a co-chaperone of HSP90 that acts as a scaffold and regulator of interaction between HSP90 and its protein kinase clients. CDC37 is frequently over-expressed in cancers involving mutant kinases and acts as an oncogene (Roe et al. 2004, reviewed by Gray Jr. et al. 2008). Over-expression of the wild-type EGFR or EGFR cancer mutants results in aberrant activation of downstream signaling cascades, namely RAS/RAF/MAP kinase signaling and PI3K/AKT signaling, and possibly signaling by PLCG1, which leads to increased cell proliferation and survival, providing selective advantage to cancer cells that harbor activating mutations in the EGFR gene (Sordella et al. 2004, Huang et al. 2007). While growth factor activated wild-type EGFR is promptly down-regulated by internalization and degradation, cancer mutants of EGFR demonstrate prolonged activation (Lynch et al. 2004). Association of HSP90 with EGFR kinase domain mutants negatively affects CBL-mediated ubiquitination, possibly through decreasing the affinity of EGFR kinase domain mutants for phosphorylated CBL, so that CBL dissociates from the complex upon phosphorylation and cannot perform ubiquitination (Yang et al. 2006, Padron et al. 2007). Various molecular therapeutics are being developed to target aberrantly activated EGFR in cancer. Non-covalent (reversible) small tyrosine kinase inhibitors (TKIs), such as gefitinib and erlotinib, selectively bind kinase domain of EGFR, competitively inhibiting ATP binding and subsequent autophosphorylation of EGFR dimers. EGFR kinase domain mutants sensitive to non-covalent TKIs exhibit greater affinity for TKIs than ATP compared with the wild-type EGFR protein, and are therefore preferential targets of non-covalent TKI therapeutics (Yun et al. 2007). EGFR proteins that harbor point mutations in the extracellular domain also show sensitivity to non-covalent tyrosine kinase inhibitors (Lee et al. 2006). EGFR kinase domain mutants harboring small insertions in exon 20 or a secondary T790M mutation are resistant to reversible TKIs (Balak et al. 2006) due to increased affinity for ATP (Yun et al. 2008), and are targets of covalent (irreversible) TKIs that form a covalent bond with EGFR cysteine residue C397. However, effective concentrations of covalent TKIs also inhibit wild-type EGFR, causing severe side effects (Zhou et al. 2009). Hence, covalent TKIs have not shown much promise in clinical trials (Reviewed by Pao and Chmielecki in 2010) R-HSA-5637810 Constitutive Signaling by EGFRvIII. In glioblastoma, the most prevalent EGFR mutation, present in ~25% of tumors, is the deletion of the ligand binding domain of EGFR, accompanied with amplification of the mutated allele, which results in over-expression of the mutant protein known as EGFRvIII. EGFRvIII mutant is not able to bind a ligand, but dimerizes and autophosphorylates spontaneously and is therefore constitutively active (Fernandes et al. 2001). Point mutations in the extracellular domain of EGFR are also frequently found in glioblastoma, but ligand binding ability and responsiveness are preserved (Lee et al. 2006). Similar to EGFR kinase domain mutants, EGFRvIII mutant needs to maintain association with the chaperone heat shock protein 90 (HSP90) for proper functioning (Shimamura et al. 2005, Lavictoire et al. 2003). CDC37 is a co-chaperone of HSP90 that acts as a scaffold and regulator of interaction between HSP90 and its protein kinase clients. CDC37 is frequently over-expressed in cancers involving mutant kinases and acts as an oncogene (Roe et al. 2004, reviewed by Gray Jr. et al. 2008). Expression of EGFRvIII mutant results in aberrant activation of downstream signaling cascades, namely RAS/RAF/MAP kinase signaling and PI3K/AKT signaling, and possibly signaling by PLCG1, which leads to increased cell proliferation and survival, providing selective advantage to cancer cells that harbor EGFRvIII (Huang et al. 2007). EGFRvIII mutant does not autophosorylate on the tyrosine residue Y1045, a docking site for CBL, and is therefore unable to recruit CBL ubiquitin ligase, which enables it to escape degradation (Han et al R-HSA-8863795 Downregulation of ERBB2 signaling. Signaling by ERBB2 can be downregulated by ubiquitination and subsequent proteasome-dependent degradation of ERBB2 or activated ERBB2 heterodimers. In addition, protein tyrosine phosphatases that dephosphorylate tyrosine residues in the C-terminus of ERBB2 prevent the recruitment of adapter proteins involved in signal transduction, thus attenuating ERBB2 signaling.STUB1 (CHIP) and CUL5 are E3 ubiquitin ligases that can target non-activated ERBB2 for proteasome-dependent degradation (Xu et al. 2002, Ehrlich et al. 2009). RNF41 (NRDP1) is an E3 ubiquitin ligase that targets ERBB3 and activated heterodimers of ERBB2 and ERBB3 for proteasome-dependent degradation by ubiquitinating ERBB3 (Cao et al. 2007).Two protein tyrosine phosphatases of the PEST family, PTPN12 and PTPN18, dephosphorylate tyrosine residues in the C-terminus of ERBB2, thus preventing signal transduction to RAS and PI3K effectors (Sun et al. 2011, Wang et al. 2014)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source A2M Two-hybrid physical 21163940 , (Europe PMC )NA BioGRID ABL2 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct AHCYL1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID AHSA1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct AIP Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct AKT1 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation association, physical, physical association 12176997 , 22504172 , 24869908 , (Europe PMC )0.50 BioGRID, IntAct AKT3 Affinity Capture-MS, coimmunoprecipitation, luminescence based mammalian interactome mapping physical, physical association 12176997 , 25036637 , 28514442 , (Europe PMC )0.59 BioGRID, IntAct APOE Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array association, physical, physical association 21163940 , (Europe PMC )0.48 BioGRID, IntAct APP Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct AR Reconstituted Complex physical 11085988 , (Europe PMC )NA BioGRID ARAF Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 24189400 , 25036637 , (Europe PMC )0.53 BioGRID, IntAct ATG101 Affinity Capture-MS physical 20562859 , (Europe PMC )NA BioGRID AURKA Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID AURKB Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, proximity-dependent biotin identification, pull down association, physical, physical association 25036637 , 26186194 , 29568061 , (Europe PMC )0.66 BioGRID, IntAct AURKC Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID BRAF Affinity Capture-MS, tandem affinity purification association, physical 17979178 , 27034005 , (Europe PMC )0.35 BioGRID, IntAct BRCA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID BTBD10 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT BTK Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID C19orf44 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CC2D1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CDC25C Affinity Capture-MS, Affinity Capture-Western, pull down association, physical 17525741 , 27432908 , 28330616 , (Europe PMC )0.35 BioGRID, IntAct CDC37 Affinity Capture-MS, Co-fractionation, PCA, Reconstituted Complex physical 11916974 , 21675959 , 24189400 , (Europe PMC )NA BioGRID CDC37L1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct CDCA5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CDK1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17525741 , 25036637 , (Europe PMC )0.35 BioGRID, IntAct CDK11A Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 24189400 , 25036637 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct CDK11B Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 15344906 , 24189400 , (Europe PMC )0.35 BioGRID, IntAct CDK13 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , (Europe PMC )0.40 BioGRID, IntAct CDK15 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , (Europe PMC )0.40 BioGRID, IntAct CDK18 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CDK4 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, electron tomography, molecular sieving, tandem affinity purification, two hybrid association, physical, physical association 11867521 , 17353931 , 21675959 , 21871133 , 24189400 , 25036637 , 26186194 , 27339980 , 28514442 , 8666233 , 8703009 , 9150368 , (Europe PMC )0.89 BioGRID, IntAct CDK5 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct CDK6 Reconstituted Complex, coimmunoprecipitation, luminescence based mammalian interactome mapping, two hybrid physical, physical association 25036637 , 8666233 , 9150368 , (Europe PMC )0.65 BioGRID, IntAct CDK7 Affinity Capture-MS, Reconstituted Complex, proximity-dependent biotin identification, pull down association, physical 26186194 , 29568061 , 8666233 , (Europe PMC )0.46 BioGRID, IntAct CDK9 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 20305087 , 23455922 , 24189400 , 25036637 , 26186194 , 28514442 , (Europe PMC )0.67 BioGRID, IntAct CDKL1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CDKL2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CEP104 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CFTR Affinity Capture-MS physical 26618866 , (Europe PMC )NA BioGRID CHGA Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CHORDC1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct CHUK Affinity Capture-Luminescence, Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 11864612 , 14743216 , 21903422 , 24189400 , 25036637 , (Europe PMC )0.74 BioGRID, IntAct CKS1B Reconstituted Complex physical 19786724 , (Europe PMC )NA BioGRID CKS2 Reconstituted Complex physical 19786724 , (Europe PMC )NA BioGRID CLK3 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct CPLANE2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CRYM Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CTTN Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 24189400 , 25036637 , (Europe PMC )0.53 BioGRID, IntAct CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID CYP2C9 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct DCTN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DDR1 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct DDX17 Affinity Capture-Luminescence, Affinity Capture-MS, tandem affinity purification association, physical 24189400 , 25036637 , (Europe PMC )0.35 BioGRID, IntAct DDX5 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct DEAF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DLD Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DMWD Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct DNAJB1 Affinity Capture-Luminescence, Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, two hybrid array association, physical, physical association 21163940 , 25036637 , (Europe PMC )0.55 BioGRID, IntAct DNAJC7 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct DNM1L Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct ECSIT Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct EDEM3 Affinity Capture-MS physical 28366632 , (Europe PMC )NA BioGRID EEF1A1 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID EEF1A1P5 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID EEF1A2 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID EGFR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 12471035 , 23956138 , 24189400 , 25036637 , (Europe PMC )0.62 BioGRID, IntAct EIF2AK1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 11036079 , (Europe PMC )0.35 BioGRID, IntAct EIF2AK2 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct EIF2S1 Reconstituted Complex physical 12930845 , (Europe PMC )NA BioGRID EIF3B Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID ELAVL3 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct EMD Affinity Capture-MS physical 17620012 , (Europe PMC )NA BioGRID ERBB2 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 24189400 , 25036637 , (Europe PMC )0.56 BioGRID, IntAct ERBB3 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct ESRRB Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID EVC2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct EWSR1 Proximity Label-MS physical 24999758 , (Europe PMC )NA BioGRID EXOSC1 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct FBXL12 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct FBXO6 Affinity Capture-MS physical 22268729 , (Europe PMC )NA BioGRID FBXW4 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct FER Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping association, physical, physical association 25036637 , (Europe PMC )0.50 BioGRID, IntAct FGFR3 Affinity Capture-MS, Affinity Capture-Western, luminescence based mammalian interactome mapping physical, physical association 21487019 , 25036637 , (Europe PMC )0.40 BioGRID, IntAct FKBP4 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping association, physical, physical association 25036637 , (Europe PMC )0.50 BioGRID, IntAct FKBP5 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct FKBP6 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct FKBPL Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct FLCN Affinity Capture-Western physical 27353360 , (Europe PMC )NA BioGRID FNIP1 Affinity Capture-Western physical 27353360 , (Europe PMC )NA BioGRID FNIP2 Affinity Capture-Western physical 27353360 , (Europe PMC )NA BioGRID FTSJ1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID FYN Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 28514442 , (Europe PMC )0.40 BioGRID, IntAct GCDH Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct GCH1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GFAP Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 24189400 , (Europe PMC )0.49 BioGRID, IntAct GLMN Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct GRK5 Affinity Capture-MS physical 22952844 , (Europe PMC )NA BioGRID HCK Affinity Capture-Western physical 11413142 , (Europe PMC )NA BioGRID HNRNPM Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct HSP90AA1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 11413142 , 12176997 , 12930845 , 14718169 , 15001580 , 15647277 , 19875381 , 20159553 , 21360678 , 21871133 , 22315411 , 22504172 , 22729780 , 22939624 , 24189400 , 24462205 , 25036637 , 25486457 , 26496610 , 26804907 , 27353360 , 9685350 , (Europe PMC )0.35, 0.89 BioGRID, IntAct HSP90AB1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, electron tomography, luminescence based mammalian interactome mapping, molecular sieving, tandem affinity purification association, physical, physical association 11036079 , 22939624 , 23428871 , 24189400 , 25036637 , 25486457 , 26496610 , 27339980 , 28215707 , (Europe PMC )0.89 BioGRID, IntAct HSPA1A Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID HSPA5 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID HSPA8 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID IFIT3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array association, direct interaction, physical, physical association 21163940 , (Europe PMC )0.58 BioGRID, IntAct IFIT5 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct IKBKB Affinity Capture-Luminescence, Affinity Capture-MS, Co-purification, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 11864612 , 14743216 , 21903422 , 25036637 , 26496610 , (Europe PMC )0.74 BioGRID, IntAct IKBKE Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 14743216 , 17353931 , 21903422 , 25036637 , (Europe PMC )0.77 BioGRID, IntAct IKBKG Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 11864612 , 14743216 , 24189400 , 24618592 , 25036637 , 26496610 , (Europe PMC )0.80 BioGRID, IntAct IMMT Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT IRAK1 Affinity Capture-Western, Co-fractionation physical 15647277 , (Europe PMC )NA BioGRID IRAK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21903422 , (Europe PMC )0.35 BioGRID, IntAct ITK Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID LONP1 Two-hybrid physical 21163940 , (Europe PMC )NA BioGRID LOXL4 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct LRRK1 Affinity Capture-MS physical 20697350 , (Europe PMC )NA BioGRID LRRK2 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 16321986 , 18367605 , 20642453 , 22612223 , 23075850 , 26355680 , (Europe PMC )0.85 BioGRID, IntAct LUC7L2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAP2K5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAP3K1 Affinity Capture-MS, tandem affinity purification physical, physical association 14743216 , (Europe PMC )0.40 BioGRID, IntAct MAP3K11 Affinity Capture-MS, Affinity Capture-Western physical 15001580 , (Europe PMC )NA BioGRID MAP3K3 Affinity Capture-MS, tandem affinity purification physical, physical association 14743216 , (Europe PMC )0.40 BioGRID, IntAct MAP3K6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAP3K7 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 14743216 , 19026643 , (Europe PMC )0.62 BioGRID, IntAct, MINT MAPK7 Affinity Capture-Western, luminescence based mammalian interactome mapping physical, physical association 23428871 , 25036637 , (Europe PMC )0.40 BioGRID, IntAct MASP1 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct MOV10 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID MTOR Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MYLK4 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , (Europe PMC )0.40 BioGRID, IntAct MZT2B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NCOA5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NEK6 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct NEK8 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct NOS3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array association, direct interaction, physical, physical association 21163940 , (Europe PMC )0.58 BioGRID, IntAct NPM1 Affinity Capture-MS physical 23402259 , (Europe PMC )NA BioGRID NTRK1 Affinity Capture-MS, Affinity Capture-Western physical 20663926 , 25921289 , (Europe PMC )NA BioGRID NUP98 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct NXF1 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID OFD1 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct OGA Co-fractionation, Two-hybrid physical 21163940 , 22863883 , 26344197 , (Europe PMC )NA BioGRID OGFR Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PANX1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PATL1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PCBP1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PDIK1L Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 28514442 , (Europe PMC )0.40 BioGRID, IntAct PDZK1 Affinity Capture-Western physical 24869908 , (Europe PMC )NA BioGRID PINK1 Affinity Capture-MS, Affinity Capture-Western, luminescence based mammalian interactome mapping physical, physical association 18003639 , 18359116 , 21151955 , 25036637 , 28438176 , (Europe PMC )0.40 BioGRID, IntAct PKM Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID POC1B Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct PPHLN1 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID PPID Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct PPP5C Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, pull down association, physical, physical association 21360678 , 25036637 , 28330616 , (Europe PMC )0.71 BioGRID, IntAct PPP6R3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PRAM1 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct PRDX2 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct PRKAA1 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 16306228 , 25036637 , (Europe PMC )0.35, 0.40 BioGRID, IntAct PRKCI Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 14676191 , (Europe PMC )0.35 BioGRID, IntAct PRMT1 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID PRPF4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PSEN1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array association, physical, physical association 21163940 , (Europe PMC )0.48 BioGRID, IntAct PSKH2 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , 28514442 , (Europe PMC )0.40 BioGRID, IntAct PSME1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PTGES3 Reconstituted Complex physical 22504172 , (Europe PMC )NA BioGRID RAD23A Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct RAE1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct RAF1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 17979178 , 24189400 , 25036637 , (Europe PMC )0.71 BioGRID, IntAct RASSF3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct RHOBTB2 Affinity Capture-MS physical 24608665 , (Europe PMC )NA BioGRID RIPK3 Affinity Capture-MS, tandem affinity purification physical, physical association 14743216 , 21903422 , (Europe PMC )0.40 BioGRID, IntAct RNF32 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct RPAP3 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct RPS15A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RPS2 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct RPS27 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID RPS27L Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID RPS6KA1 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct RPS6KA3 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct RPS6KA4 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct RPS6KA6 Affinity Capture-MS, Co-fractionation, tandem affinity purification association, physical 22939629 , 24189400 , (Europe PMC )0.35 BioGRID, IntAct RPS6KB2 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID RYK Affinity Capture-MS physical 21875946 , (Europe PMC )NA BioGRID SAFB Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SGK1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct SKP1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct SLC25A5 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID SLC25A6 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID SMYD2 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct SMYD3 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct SNRPE Affinity Capture-Western physical 16322212 , (Europe PMC )NA BioGRID SNX5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SPTBN4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SQSTM1 Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 20562859 , 21900206 , 24189400 , (Europe PMC )0.79 BioGRID, IntAct, MINT SRC Reconstituted Complex physical 11085988 , (Europe PMC )NA BioGRID SSB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STAMBPL1 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct STIL Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct STK11 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping association, physical, physical association 14668798 , 14676191 , 20562859 , 21860411 , 25036637 , (Europe PMC )0.69 BioGRID, IntAct STK32C Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID STK33 Affinity Capture-MS, Affinity Capture-Western physical 22451720 , (Europe PMC )NA BioGRID STK35 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID STK36 Affinity Capture-Western physical 17054904 , (Europe PMC )NA BioGRID STK38L Affinity Capture-MS physical 24366813 , (Europe PMC )NA BioGRID STK4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct STUB1 Affinity Capture-Luminescence, Affinity Capture-MS physical 25036637 , (Europe PMC )NA BioGRID SYNE2 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TARS2 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TBK1 Affinity Capture-MS, tandem affinity purification physical, physical association 14743216 , (Europe PMC )0.40 BioGRID, IntAct TERF1 Affinity Capture-MS physical 20811636 , (Europe PMC )NA BioGRID TERF2 Affinity Capture-MS physical 20811636 , (Europe PMC )NA BioGRID TNK2 Affinity Capture-MS physical 28514442 , 28739485 , (Europe PMC )NA BioGRID TOMM34 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TPM1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TTC4 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TTC9C Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TUBA1B Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID TUBA1C Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID TUBB Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID U2AF2 Affinity Capture-MS physical 26641092 , (Europe PMC )NA BioGRID UBE2I Biochemical Activity physical 17709345 , (Europe PMC )NA BioGRID ULK1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct ULK3 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , (Europe PMC )0.40 BioGRID, IntAct UNC45A Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct UPF1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct USP19 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct USP7 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID VCP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID WDR6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct YES1 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 28514442 , (Europe PMC )0.40 BioGRID, IntAct YWHAE Affinity Capture-MS physical 20462248 , (Europe PMC )NA BioGRID YWHAQ Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct ZNF205 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF235 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF266 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF667 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABL2 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct AHSA1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct AIP Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct AKT1 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation association, physical, physical association 12176997 , 22504172 , 24869908 , (Europe PMC )0.50 BioGRID, IntAct AKT2 coimmunoprecipitation physical association 12176997 , (Europe PMC )0.40 IntAct AKT3 Affinity Capture-MS, coimmunoprecipitation, luminescence based mammalian interactome mapping physical, physical association 12176997 , 25036637 , 28514442 , (Europe PMC )0.59 BioGRID, IntAct ALS2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct AMHR2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct APOE Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array association, physical, physical association 21163940 , (Europe PMC )0.48 BioGRID, IntAct APP Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct ARAF Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 24189400 , 25036637 , (Europe PMC )0.53 BioGRID, IntAct ATG12 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct AURKB Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, proximity-dependent biotin identification, pull down association, physical, physical association 25036637 , 26186194 , 29568061 , (Europe PMC )0.66 BioGRID, IntAct BRAF Affinity Capture-MS, tandem affinity purification association, physical 17979178 , 27034005 , (Europe PMC )0.35 BioGRID, IntAct BTBD10 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT C12orf76 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct C19orf44 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CC2D1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CDC25C Affinity Capture-MS, Affinity Capture-Western, pull down association, physical 17525741 , 27432908 , 28330616 , (Europe PMC )0.35 BioGRID, IntAct CDC37L1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct CDCA5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CDK1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17525741 , 25036637 , (Europe PMC )0.35 BioGRID, IntAct CDK10 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct CDK11A Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 24189400 , 25036637 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct CDK11B Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 15344906 , 24189400 , (Europe PMC )0.35 BioGRID, IntAct CDK13 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , (Europe PMC )0.40 BioGRID, IntAct CDK15 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , (Europe PMC )0.40 BioGRID, IntAct CDK4 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, electron tomography, molecular sieving, tandem affinity purification, two hybrid association, physical, physical association 11867521 , 17353931 , 21675959 , 21871133 , 24189400 , 25036637 , 26186194 , 27339980 , 28514442 , 8666233 , 8703009 , 9150368 , (Europe PMC )0.89 BioGRID, IntAct CDK5 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct CDK6 Reconstituted Complex, coimmunoprecipitation, luminescence based mammalian interactome mapping, two hybrid physical, physical association 25036637 , 8666233 , 9150368 , (Europe PMC )0.65 BioGRID, IntAct CDK7 Affinity Capture-MS, Reconstituted Complex, proximity-dependent biotin identification, pull down association, physical 26186194 , 29568061 , 8666233 , (Europe PMC )0.46 BioGRID, IntAct CDK8 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct CDK9 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 20305087 , 23455922 , 24189400 , 25036637 , 26186194 , 28514442 , (Europe PMC )0.67 BioGRID, IntAct CEP104 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CFLAR anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CHGA Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CHORDC1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct CHUK Affinity Capture-Luminescence, Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 11864612 , 14743216 , 21903422 , 24189400 , 25036637 , (Europe PMC )0.74 BioGRID, IntAct CLK3 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct CRYM Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CSNK2A2 tandem affinity purification association 27705803 , (Europe PMC )0.35 IntAct CTTN Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 24189400 , 25036637 , (Europe PMC )0.53 BioGRID, IntAct CUL3 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct CUL4A luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct CUL4B luminescence based mammalian interactome mapping physical association 22939624 , 25036637 , (Europe PMC )0.59 IntAct CYP2C9 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct DAPK3 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct DCTN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DDR1 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct DDR2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct DDX17 Affinity Capture-Luminescence, Affinity Capture-MS, tandem affinity purification association, physical 24189400 , 25036637 , (Europe PMC )0.35 BioGRID, IntAct DDX5 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct DEAF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DLD Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DMWD Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct DNAJB1 Affinity Capture-Luminescence, Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, two hybrid array association, physical, physical association 21163940 , 25036637 , (Europe PMC )0.55 BioGRID, IntAct DNAJC7 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct DNM1L Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DPCD luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct DPF1 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct DUS3L luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct EBI-8770671 tandem affinity purification association 24189400 , (Europe PMC )0.35 IntAct EBI-8770676 tandem affinity purification association 24189400 , (Europe PMC )0.35 IntAct ECSIT Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct EGFR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 12471035 , 23956138 , 24189400 , 25036637 , (Europe PMC )0.62 BioGRID, IntAct EIF1B anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EIF2AK1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 11036079 , (Europe PMC )0.35 BioGRID, IntAct EIF2AK2 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct EIF2AK4 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct EIF3B tandem affinity purification association 24189400 , (Europe PMC )0.35 IntAct ELAVL3 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct ELK3 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ERBB2 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 24189400 , 25036637 , (Europe PMC )0.56 BioGRID, IntAct ERBB3 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct EVC2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct EXOSC1 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct FBXL12 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct FBXO38 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct FBXW2 luminescence based mammalian interactome mapping physical association 22939624 , 25036637 , (Europe PMC )0.59 IntAct FBXW4 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct FER Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping association, physical, physical association 25036637 , (Europe PMC )0.50 BioGRID, IntAct FGFR3 Affinity Capture-MS, Affinity Capture-Western, luminescence based mammalian interactome mapping physical, physical association 21487019 , 25036637 , (Europe PMC )0.40 BioGRID, IntAct FKBP4 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping association, physical, physical association 25036637 , (Europe PMC )0.50 BioGRID, IntAct FKBP5 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct FKBP6 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct FKBPL Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct FOXM1 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct FTSJ1 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct FYN Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 28514442 , (Europe PMC )0.40 BioGRID, IntAct GCDH Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct GCH1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GFAP Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 24189400 , (Europe PMC )0.49 BioGRID, IntAct GLMN Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct GRK2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct GSK3B proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct GTF2F1 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct GTF2IRD2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct H2AFY2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct HNRNPM Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct HSP90AA1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 11413142 , 12176997 , 12930845 , 14718169 , 15001580 , 15647277 , 19875381 , 20159553 , 21360678 , 21871133 , 22315411 , 22504172 , 22729780 , 22939624 , 24189400 , 24462205 , 25036637 , 25486457 , 26496610 , 26804907 , 27353360 , 9685350 , (Europe PMC )0.35, 0.89 BioGRID, IntAct HSP90AB1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, electron tomography, luminescence based mammalian interactome mapping, molecular sieving, tandem affinity purification association, physical, physical association 11036079 , 22939624 , 23428871 , 24189400 , 25036637 , 25486457 , 26496610 , 27339980 , 28215707 , (Europe PMC )0.89 BioGRID, IntAct HSPA5 tandem affinity purification association 24189400 , (Europe PMC )0.35 IntAct IFIT3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array association, direct interaction, physical, physical association 21163940 , (Europe PMC )0.58 BioGRID, IntAct IFIT5 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct IKBKB Affinity Capture-Luminescence, Affinity Capture-MS, Co-purification, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 11864612 , 14743216 , 21903422 , 25036637 , 26496610 , (Europe PMC )0.74 BioGRID, IntAct IKBKE Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 14743216 , 17353931 , 21903422 , 25036637 , (Europe PMC )0.77 BioGRID, IntAct IKBKG Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 11864612 , 14743216 , 24189400 , 24618592 , 25036637 , 26496610 , (Europe PMC )0.80 BioGRID, IntAct IMMT Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT IRAK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21903422 , (Europe PMC )0.35 BioGRID, IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KERA luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct KLHDC10 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct KLHL31 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct KSR2 anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping association, physical association 25036637 , 27086506 , (Europe PMC )0.56 IntAct L3MBTL1 tandem affinity purification association 27705803 , (Europe PMC )0.35 IntAct LIMK2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct LMX1B luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct LONP1 two hybrid array physical association 21163940 , (Europe PMC )0.37 IntAct LOXL4 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct LRRK2 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 16321986 , 18367605 , 20642453 , 22612223 , 23075850 , 26355680 , (Europe PMC )0.85 BioGRID, IntAct LUC7L2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAK luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct MAP3K1 Affinity Capture-MS, tandem affinity purification physical, physical association 14743216 , (Europe PMC )0.40 BioGRID, IntAct MAP3K14 luminescence based mammalian interactome mapping, tandem affinity purification physical association 14743216 , 25036637 , (Europe PMC )0.59 IntAct MAP3K15 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct MAP3K3 Affinity Capture-MS, tandem affinity purification physical, physical association 14743216 , (Europe PMC )0.40 BioGRID, IntAct MAP3K7 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 14743216 , 19026643 , (Europe PMC )0.62 BioGRID, IntAct, MINT MAPK7 Affinity Capture-Western, luminescence based mammalian interactome mapping physical, physical association 23428871 , 25036637 , (Europe PMC )0.40 BioGRID, IntAct MASP1 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct MATK luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct MEF2B luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct MGEA5 two hybrid array physical association 21163940 , (Europe PMC )0.37 IntAct MOK luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct MOS luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct MRPL28 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct MTOR Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MUSK luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct MYLK4 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , (Europe PMC )0.40 BioGRID, IntAct MZT2B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NCOA5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NEK6 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct NEK8 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct NFRKB luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct NLRP12 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct NOC4L luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct NOD1 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct NOS3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array association, direct interaction, physical, physical association 21163940 , (Europe PMC )0.58 BioGRID, IntAct NPR2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct NR1I3 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct NUAK2 tandem affinity purification association 16306228 , (Europe PMC )0.35 IntAct NUP98 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct OFD1 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct PANX1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PDIK1L Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 28514442 , (Europe PMC )0.40 BioGRID, IntAct PDPK1 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct PINK1 Affinity Capture-MS, Affinity Capture-Western, luminescence based mammalian interactome mapping physical, physical association 18003639 , 18359116 , 21151955 , 25036637 , 28438176 , (Europe PMC )0.40 BioGRID, IntAct PITX2 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct POC1B Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct POLR1E anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PPHLN1 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT PPID Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct PPM1M pull down association 28330616 , (Europe PMC )0.35 IntAct PPP2R1A proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PPP5C Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, pull down association, physical, physical association 21360678 , 25036637 , 28330616 , (Europe PMC )0.71 BioGRID, IntAct PRAM1 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct PRDM1 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct PRDX2 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct PRKAA1 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 16306228 , 25036637 , (Europe PMC )0.35, 0.40 BioGRID, IntAct PRKAB1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PRKCI Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 14676191 , (Europe PMC )0.35 BioGRID, IntAct PRMT1 two hybrid, two hybrid array, two hybrid prey pooling approach physical association 21900206 , (Europe PMC )0.37, 0.49 IntAct, MINT PRPF4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PSEN1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array association, physical, physical association 21163940 , (Europe PMC )0.48 BioGRID, IntAct PSKH2 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , 28514442 , (Europe PMC )0.40 BioGRID, IntAct PSME1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RAD23A Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct RAE1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct RAF1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 17979178 , 24189400 , 25036637 , (Europe PMC )0.71 BioGRID, IntAct RASSF3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct RGS11 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct RIPK1 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct RIPK3 Affinity Capture-MS, tandem affinity purification physical, physical association 14743216 , 21903422 , (Europe PMC )0.40 BioGRID, IntAct RIPK4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RNF32 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct RPAP3 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct RPS15A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RPS2 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct RPS6KA1 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct RPS6KA3 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct RPS6KA4 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct RPS6KA6 Affinity Capture-MS, Co-fractionation, tandem affinity purification association, physical 22939629 , 24189400 , (Europe PMC )0.35 BioGRID, IntAct SAFB Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SGK1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct SKP1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct SLITRK6 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct SMYD2 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct SMYD3 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct SNX5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SPTBN4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SQSTM1 Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 20562859 , 21900206 , 24189400 , (Europe PMC )0.79 BioGRID, IntAct, MINT STAMBPL1 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct STIL Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct STK11 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping association, physical, physical association 14668798 , 14676191 , 20562859 , 21860411 , 25036637 , (Europe PMC )0.69 BioGRID, IntAct STK38L anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping association, physical association 24366813 , 25036637 , (Europe PMC )0.56 IntAct STK4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct STUB1 anti tag coimmunoprecipitation association 25036637 , (Europe PMC )0.35 IntAct SYNE2 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TARS2 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TBK1 Affinity Capture-MS, tandem affinity purification physical, physical association 14743216 , (Europe PMC )0.40 BioGRID, IntAct TESK2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct TIE1 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct TNFRSF14 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TNK1 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct TOMM34 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TRAF6 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TSSK6 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct TTC4 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TTC9C Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TUBB1 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct TUT1 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ULK1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct ULK2 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct ULK3 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , (Europe PMC )0.40 BioGRID, IntAct UNC45A Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct UPF1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct URI1 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct USP19 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct USP49 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct VSX2 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct WDR13 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct WDR6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct WDR61 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct WDR70 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct YES1 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 28514442 , (Europe PMC )0.40 BioGRID, IntAct YWHAQ Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct ZBTB20 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ZBTB40 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ZGPAT luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ZNF205 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF235 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF266 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF334 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ZNF569 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ZNF587 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ZNF610 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ZNF667 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF843 luminescence based mammalian interactome mapping physical association 22939624 , 25036637 , (Europe PMC )0.59 IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source BTBD10 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT C19orf44 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CC2D1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CHGA Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CRYM Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DCTN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DEAF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GCH1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT IMMT Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT LUC7L2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAP3K7 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 14743216 , 19026643 , (Europe PMC )0.62 BioGRID, IntAct, MINT MTOR Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MZT2B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NCOA5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PPHLN1 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT PRMT1 two hybrid, two hybrid array, two hybrid prey pooling approach physical association 21900206 , (Europe PMC )0.37, 0.49 IntAct, MINT PSME1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RPS15A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SAFB Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SNX5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SPTBN4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SQSTM1 Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 20562859 , 21900206 , 24189400 , (Europe PMC )0.79 BioGRID, IntAct, MINT ZNF205 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF235 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF266 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF667 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source A2M Two-hybrid physical 21163940 , (Europe PMC )NA BioGRID ABL2 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct AHCYL1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID AHSA1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct AIP Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct AKT1 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation association, physical, physical association 12176997 , 22504172 , 24869908 , (Europe PMC )0.50 BioGRID, IntAct AKT2 coimmunoprecipitation physical association 12176997 , (Europe PMC )0.40 IntAct AKT3 Affinity Capture-MS, coimmunoprecipitation, luminescence based mammalian interactome mapping physical, physical association 12176997 , 25036637 , 28514442 , (Europe PMC )0.59 BioGRID, IntAct ALS2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct AMHR2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct APOE Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array association, physical, physical association 21163940 , (Europe PMC )0.48 BioGRID, IntAct APP Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct AR Reconstituted Complex physical 11085988 , (Europe PMC )NA BioGRID ARAF Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 24189400 , 25036637 , (Europe PMC )0.53 BioGRID, IntAct ATG101 Affinity Capture-MS physical 20562859 , (Europe PMC )NA BioGRID ATG12 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct AURKA Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID AURKB Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, proximity-dependent biotin identification, pull down association, physical, physical association 25036637 , 26186194 , 29568061 , (Europe PMC )0.66 BioGRID, IntAct AURKC Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID BRAF Affinity Capture-MS, tandem affinity purification association, physical 17979178 , 27034005 , (Europe PMC )0.35 BioGRID, IntAct BRCA1 Affinity Capture-MS physical 26831064 , (Europe PMC )NA BioGRID BTBD10 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT BTK Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID C12orf76 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct C19orf44 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CC2D1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CDC25C Affinity Capture-MS, Affinity Capture-Western, pull down association, physical 17525741 , 27432908 , 28330616 , (Europe PMC )0.35 BioGRID, IntAct CDC37 Affinity Capture-MS, Co-fractionation, PCA, Reconstituted Complex physical 11916974 , 21675959 , 24189400 , (Europe PMC )NA BioGRID CDC37L1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct CDCA5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct CDK1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 17525741 , 25036637 , (Europe PMC )0.35 BioGRID, IntAct CDK10 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct CDK11A Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 24189400 , 25036637 , 28514442 , (Europe PMC )0.53 BioGRID, IntAct CDK11B Affinity Capture-MS, Affinity Capture-Western, tandem affinity purification association, physical 15344906 , 24189400 , (Europe PMC )0.35 BioGRID, IntAct CDK13 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , (Europe PMC )0.40 BioGRID, IntAct CDK15 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , (Europe PMC )0.40 BioGRID, IntAct CDK18 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CDK4 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-fractionation, PCA, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, electron tomography, molecular sieving, tandem affinity purification, two hybrid association, physical, physical association 11867521 , 17353931 , 21675959 , 21871133 , 24189400 , 25036637 , 26186194 , 27339980 , 28514442 , 8666233 , 8703009 , 9150368 , (Europe PMC )0.89 BioGRID, IntAct CDK5 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct CDK6 Reconstituted Complex, coimmunoprecipitation, luminescence based mammalian interactome mapping, two hybrid physical, physical association 25036637 , 8666233 , 9150368 , (Europe PMC )0.65 BioGRID, IntAct CDK7 Affinity Capture-MS, Reconstituted Complex, proximity-dependent biotin identification, pull down association, physical 26186194 , 29568061 , 8666233 , (Europe PMC )0.46 BioGRID, IntAct CDK8 proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct CDK9 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 20305087 , 23455922 , 24189400 , 25036637 , 26186194 , 28514442 , (Europe PMC )0.67 BioGRID, IntAct CDKL1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CDKL2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CEP104 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct CFLAR anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct CFTR Affinity Capture-MS physical 26618866 , (Europe PMC )NA BioGRID CHGA Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CHORDC1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct CHUK Affinity Capture-Luminescence, Affinity Capture-MS, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 11864612 , 14743216 , 21903422 , 24189400 , 25036637 , (Europe PMC )0.74 BioGRID, IntAct CKS1B Reconstituted Complex physical 19786724 , (Europe PMC )NA BioGRID CKS2 Reconstituted Complex physical 19786724 , (Europe PMC )NA BioGRID CLK3 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct CPLANE2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CRYM Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CSNK2A2 tandem affinity purification association 27705803 , (Europe PMC )0.35 IntAct CTTN Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 24189400 , 25036637 , (Europe PMC )0.53 BioGRID, IntAct CUL3 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct CUL4A luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct CUL4B luminescence based mammalian interactome mapping physical association 22939624 , 25036637 , (Europe PMC )0.59 IntAct CYLD Affinity Capture-MS physical 27591049 , (Europe PMC )NA BioGRID CYP2C9 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct DAPK3 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct DCTN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DDR1 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct DDR2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct DDX17 Affinity Capture-Luminescence, Affinity Capture-MS, tandem affinity purification association, physical 24189400 , 25036637 , (Europe PMC )0.35 BioGRID, IntAct DDX5 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct DEAF1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT DLD Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DMWD Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 19615732 , (Europe PMC )0.40 BioGRID, IntAct DNAJB1 Affinity Capture-Luminescence, Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, two hybrid array association, physical, physical association 21163940 , 25036637 , (Europe PMC )0.55 BioGRID, IntAct DNAJC7 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct DNM1L Affinity Capture-MS, cross-linking study association, physical 29128334 , (Europe PMC )0.35 BioGRID, IntAct DPCD luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct DPF1 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct DUS3L luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct EBI-8770671 tandem affinity purification association 24189400 , (Europe PMC )0.35 IntAct EBI-8770676 tandem affinity purification association 24189400 , (Europe PMC )0.35 IntAct ECSIT Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct EDEM3 Affinity Capture-MS physical 28366632 , (Europe PMC )NA BioGRID EEF1A1 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID EEF1A1P5 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID EEF1A2 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID EGFR Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 12471035 , 23956138 , 24189400 , 25036637 , (Europe PMC )0.62 BioGRID, IntAct EIF1B anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EIF2AK1 Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation association, physical 11036079 , (Europe PMC )0.35 BioGRID, IntAct EIF2AK2 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct EIF2AK4 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct EIF2S1 Reconstituted Complex physical 12930845 , (Europe PMC )NA BioGRID EIF3B Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID EIF3B tandem affinity purification association 24189400 , (Europe PMC )0.35 IntAct ELAVL3 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct ELK3 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct EMD Affinity Capture-MS physical 17620012 , (Europe PMC )NA BioGRID ERBB2 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 24189400 , 25036637 , (Europe PMC )0.56 BioGRID, IntAct ERBB3 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct ESRRB Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID EVC2 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct EWSR1 Proximity Label-MS physical 24999758 , (Europe PMC )NA BioGRID EXOSC1 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct FBXL12 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct FBXO38 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct FBXO6 Affinity Capture-MS physical 22268729 , (Europe PMC )NA BioGRID FBXW2 luminescence based mammalian interactome mapping physical association 22939624 , 25036637 , (Europe PMC )0.59 IntAct FBXW4 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct FER Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping association, physical, physical association 25036637 , (Europe PMC )0.50 BioGRID, IntAct FGFR3 Affinity Capture-MS, Affinity Capture-Western, luminescence based mammalian interactome mapping physical, physical association 21487019 , 25036637 , (Europe PMC )0.40 BioGRID, IntAct FKBP4 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping association, physical, physical association 25036637 , (Europe PMC )0.50 BioGRID, IntAct FKBP5 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct FKBP6 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct FKBPL Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct FLCN Affinity Capture-Western physical 27353360 , (Europe PMC )NA BioGRID FNIP1 Affinity Capture-Western physical 27353360 , (Europe PMC )NA BioGRID FNIP2 Affinity Capture-Western physical 27353360 , (Europe PMC )NA BioGRID FOXM1 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct FTSJ1 Affinity Capture-MS physical 26496610 , (Europe PMC )NA BioGRID FTSJ1 anti tag coimmunoprecipitation association 26496610 , (Europe PMC )0.35 IntAct FYN Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 28514442 , (Europe PMC )0.40 BioGRID, IntAct GCDH Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct GCH1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT GFAP Affinity Capture-MS, two hybrid array, two hybrid prey pooling approach physical, physical association 24189400 , (Europe PMC )0.49 BioGRID, IntAct GLMN Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct GRK2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct GRK5 Affinity Capture-MS physical 22952844 , (Europe PMC )NA BioGRID GSK3B proximity-dependent biotin identification, pull down association 29568061 , (Europe PMC )0.46 IntAct GTF2F1 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct GTF2IRD2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct H2AFY2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct HCK Affinity Capture-Western physical 11413142 , (Europe PMC )NA BioGRID HNRNPM Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct HSP90AA1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 11413142 , 12176997 , 12930845 , 14718169 , 15001580 , 15647277 , 19875381 , 20159553 , 21360678 , 21871133 , 22315411 , 22504172 , 22729780 , 22939624 , 24189400 , 24462205 , 25036637 , 25486457 , 26496610 , 26804907 , 27353360 , 9685350 , (Europe PMC )0.35, 0.89 BioGRID, IntAct HSP90AB1 Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, electron tomography, luminescence based mammalian interactome mapping, molecular sieving, tandem affinity purification association, physical, physical association 11036079 , 22939624 , 23428871 , 24189400 , 25036637 , 25486457 , 26496610 , 27339980 , 28215707 , (Europe PMC )0.89 BioGRID, IntAct HSPA1A Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID HSPA5 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID HSPA5 tandem affinity purification association 24189400 , (Europe PMC )0.35 IntAct HSPA8 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID IFIT3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array association, direct interaction, physical, physical association 21163940 , (Europe PMC )0.58 BioGRID, IntAct IFIT5 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct IKBKB Affinity Capture-Luminescence, Affinity Capture-MS, Co-purification, Reconstituted Complex, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 11864612 , 14743216 , 21903422 , 25036637 , 26496610 , (Europe PMC )0.74 BioGRID, IntAct IKBKE Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 14743216 , 17353931 , 21903422 , 25036637 , (Europe PMC )0.77 BioGRID, IntAct IKBKG Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 11864612 , 14743216 , 24189400 , 24618592 , 25036637 , 26496610 , (Europe PMC )0.80 BioGRID, IntAct IMMT Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT IRAK1 Affinity Capture-Western, Co-fractionation physical 15647277 , (Europe PMC )NA BioGRID IRAK2 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 21903422 , (Europe PMC )0.35 BioGRID, IntAct ITK Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KERA luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct KLHDC10 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct KLHL31 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct KSR2 anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping association, physical association 25036637 , 27086506 , (Europe PMC )0.56 IntAct L3MBTL1 tandem affinity purification association 27705803 , (Europe PMC )0.35 IntAct LIMK2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct LMX1B luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct LONP1 Two-hybrid physical 21163940 , (Europe PMC )NA BioGRID LONP1 two hybrid array physical association 21163940 , (Europe PMC )0.37 IntAct LOXL4 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct LRRK1 Affinity Capture-MS physical 20697350 , (Europe PMC )NA BioGRID LRRK2 Affinity Capture-MS, Affinity Capture-Western, affinity chromatography technology, anti tag coimmunoprecipitation, tandem affinity purification association, physical, physical association 16321986 , 18367605 , 20642453 , 22612223 , 23075850 , 26355680 , (Europe PMC )0.85 BioGRID, IntAct LUC7L2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MAK luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct MAP2K5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAP3K1 Affinity Capture-MS, tandem affinity purification physical, physical association 14743216 , (Europe PMC )0.40 BioGRID, IntAct MAP3K11 Affinity Capture-MS, Affinity Capture-Western physical 15001580 , (Europe PMC )NA BioGRID MAP3K14 luminescence based mammalian interactome mapping, tandem affinity purification physical association 14743216 , 25036637 , (Europe PMC )0.59 IntAct MAP3K15 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct MAP3K3 Affinity Capture-MS, tandem affinity purification physical, physical association 14743216 , (Europe PMC )0.40 BioGRID, IntAct MAP3K6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAP3K7 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down, tandem affinity purification association, physical, physical association 14743216 , 19026643 , (Europe PMC )0.62 BioGRID, IntAct, MINT MAPK7 Affinity Capture-Western, luminescence based mammalian interactome mapping physical, physical association 23428871 , 25036637 , (Europe PMC )0.40 BioGRID, IntAct MASP1 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct MATK luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct MEF2B luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct MGEA5 two hybrid array physical association 21163940 , (Europe PMC )0.37 IntAct MOK luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct MOS luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct MOV10 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID MRPL28 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct MTOR Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT MUSK luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct MYLK4 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , (Europe PMC )0.40 BioGRID, IntAct MZT2B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NCOA5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT NEK6 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct NEK8 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct NFRKB luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct NLRP12 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct NOC4L luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct NOD1 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct NOS3 Affinity Capture-Western, Reconstituted Complex, Two-hybrid, anti bait coimmunoprecipitation, pull down, two hybrid array association, direct interaction, physical, physical association 21163940 , (Europe PMC )0.58 BioGRID, IntAct NPM1 Affinity Capture-MS physical 23402259 , (Europe PMC )NA BioGRID NPR2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct NR1I3 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct NTRK1 Affinity Capture-MS, Affinity Capture-Western physical 20663926 , 25921289 , (Europe PMC )NA BioGRID NUAK2 tandem affinity purification association 16306228 , (Europe PMC )0.35 IntAct NUP98 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct NXF1 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID OFD1 Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct OGA Co-fractionation, Two-hybrid physical 21163940 , 22863883 , 26344197 , (Europe PMC )NA BioGRID OGFR Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PANX1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PATL1 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PCBP1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PDIK1L Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 28514442 , (Europe PMC )0.40 BioGRID, IntAct PDPK1 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct PDZK1 Affinity Capture-Western physical 24869908 , (Europe PMC )NA BioGRID PINK1 Affinity Capture-MS, Affinity Capture-Western, luminescence based mammalian interactome mapping physical, physical association 18003639 , 18359116 , 21151955 , 25036637 , 28438176 , (Europe PMC )0.40 BioGRID, IntAct PITX2 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct PKM Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID POC1B Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct POLR1E anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PPHLN1 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID PPHLN1 two hybrid physical association 21900206 , (Europe PMC )0.37 IntAct, MINT PPID Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct PPM1M pull down association 28330616 , (Europe PMC )0.35 IntAct PPP2R1A proximity-dependent biotin identification, pull down association 28330616 , (Europe PMC )0.46 IntAct PPP5C Affinity Capture-Luminescence, Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, pull down association, physical, physical association 21360678 , 25036637 , 28330616 , (Europe PMC )0.71 BioGRID, IntAct PPP6R3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID PRAM1 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct PRDM1 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct PRDX2 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct PRKAA1 Affinity Capture-MS, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 16306228 , 25036637 , (Europe PMC )0.35, 0.40 BioGRID, IntAct PRKAB1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PRKCI Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 14676191 , (Europe PMC )0.35 BioGRID, IntAct PRMT1 Two-hybrid physical 21900206 , (Europe PMC )NA BioGRID PRMT1 two hybrid, two hybrid array, two hybrid prey pooling approach physical association 21900206 , (Europe PMC )0.37, 0.49 IntAct, MINT PRPF4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct PSEN1 Affinity Capture-Western, Two-hybrid, anti bait coimmunoprecipitation, two hybrid array association, physical, physical association 21163940 , (Europe PMC )0.48 BioGRID, IntAct PSKH2 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , 28514442 , (Europe PMC )0.40 BioGRID, IntAct PSME1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PTGES3 Reconstituted Complex physical 22504172 , (Europe PMC )NA BioGRID RAD23A Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct RAE1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct RAF1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping, tandem affinity purification association, physical, physical association 17979178 , 24189400 , 25036637 , (Europe PMC )0.71 BioGRID, IntAct RASSF3 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct RGS11 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct RHOBTB2 Affinity Capture-MS physical 24608665 , (Europe PMC )NA BioGRID RIPK1 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct RIPK3 Affinity Capture-MS, tandem affinity purification physical, physical association 14743216 , 21903422 , (Europe PMC )0.40 BioGRID, IntAct RIPK4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RNF32 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct RPAP3 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct RPS15A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT RPS2 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct RPS27 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID RPS27L Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID RPS6KA1 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct RPS6KA3 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct RPS6KA4 Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct RPS6KA6 Affinity Capture-MS, Co-fractionation, tandem affinity purification association, physical 22939629 , 24189400 , (Europe PMC )0.35 BioGRID, IntAct RPS6KB2 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID RYK Affinity Capture-MS physical 21875946 , (Europe PMC )NA BioGRID SAFB Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SGK1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct SKP1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct SLC25A5 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID SLC25A6 Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID SLITRK6 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct SMYD2 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct SMYD3 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct SNRPE Affinity Capture-Western physical 16322212 , (Europe PMC )NA BioGRID SNX5 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SPTBN4 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SQSTM1 Affinity Capture-MS, Two-hybrid, anti tag coimmunoprecipitation, tandem affinity purification, two hybrid, two hybrid array, two hybrid prey pooling approach association, physical, physical association 20562859 , 21900206 , 24189400 , (Europe PMC )0.79 BioGRID, IntAct, MINT SRC Reconstituted Complex physical 11085988 , (Europe PMC )NA BioGRID SSB Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID STAMBPL1 Two-hybrid, two hybrid array physical, physical association 21163940 , (Europe PMC )0.37 BioGRID, IntAct STIL Proximity Label-MS, proximity-dependent biotin identification association, physical 26638075 , (Europe PMC )0.35 BioGRID, IntAct STK11 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping association, physical, physical association 14668798 , 14676191 , 20562859 , 21860411 , 25036637 , (Europe PMC )0.69 BioGRID, IntAct STK32C Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID STK33 Affinity Capture-MS, Affinity Capture-Western physical 22451720 , (Europe PMC )NA BioGRID STK35 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID STK36 Affinity Capture-Western physical 17054904 , (Europe PMC )NA BioGRID STK38L Affinity Capture-MS physical 24366813 , (Europe PMC )NA BioGRID STK38L anti tag coimmunoprecipitation, luminescence based mammalian interactome mapping association, physical association 24366813 , 25036637 , (Europe PMC )0.56 IntAct STK4 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 24366813 , (Europe PMC )0.35 BioGRID, IntAct STUB1 Affinity Capture-Luminescence, Affinity Capture-MS physical 25036637 , (Europe PMC )NA BioGRID STUB1 anti tag coimmunoprecipitation association 25036637 , (Europe PMC )0.35 IntAct SYNE2 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TARS2 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TBK1 Affinity Capture-MS, tandem affinity purification physical, physical association 14743216 , (Europe PMC )0.40 BioGRID, IntAct TERF1 Affinity Capture-MS physical 20811636 , (Europe PMC )NA BioGRID TERF2 Affinity Capture-MS physical 20811636 , (Europe PMC )NA BioGRID TESK2 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct TIE1 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct TNFRSF14 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TNK1 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct TNK2 Affinity Capture-MS physical 28514442 , 28739485 , (Europe PMC )NA BioGRID TOMM34 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TPM1 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TRAF6 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TSSK6 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct TTC4 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TTC9C Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct TUBA1B Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID TUBA1C Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID TUBB Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID TUBB1 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct TUT1 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct U2AF2 Affinity Capture-MS physical 26641092 , (Europe PMC )NA BioGRID UBE2I Biochemical Activity physical 17709345 , (Europe PMC )NA BioGRID ULK1 Affinity Capture-MS, anti tag coimmunoprecipitation physical, physical association 20562859 , (Europe PMC )0.40 BioGRID, IntAct ULK2 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct ULK3 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 26186194 , (Europe PMC )0.40 BioGRID, IntAct UNC45A Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct UPF1 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct URI1 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct USP19 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct USP49 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct USP7 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID VCP Affinity Capture-MS physical 23383273 , (Europe PMC )NA BioGRID VSX2 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct WDR13 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct WDR6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct WDR61 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct WDR70 luminescence based mammalian interactome mapping physical association 25036637 , (Europe PMC )0.40 IntAct YES1 Affinity Capture-MS, luminescence based mammalian interactome mapping physical, physical association 25036637 , 28514442 , (Europe PMC )0.40 BioGRID, IntAct YWHAE Affinity Capture-MS physical 20462248 , (Europe PMC )NA BioGRID YWHAQ Affinity Capture-MS, tandem affinity purification association, physical 24189400 , (Europe PMC )0.35 BioGRID, IntAct ZBTB20 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ZBTB40 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ZGPAT luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ZNF205 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF235 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF266 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF334 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ZNF569 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ZNF587 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ZNF610 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct ZNF667 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ZNF843 luminescence based mammalian interactome mapping physical association 22939624 , 25036637 , (Europe PMC )0.59 IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
CK2_alpha S13_VWDHIEVsDDEDETH , LTP 12930845 , 15082798 ,(Europe PMC )PhosphoELM , CK2_group S13_VWDHIEVsDDEDETH , LTP 12930845 , 15082798 ,(Europe PMC )PhosphoELM , CSNK2A1 S13_VWDHIEVsDDEDETH , in vivo 12930845 , 15082798 , 19413330 , 20068231 ,(Europe PMC )HPRD, PhosphoSitePlus , CSNK2A2 S13_VWDHIEVsDDEDETH , in vivo 12930845 , 15082798 , 19413330 , 20068231 ,(Europe PMC )HPRD, PhosphoSitePlus , ULK1 S339_HMQRCIDsGLWVPNS , NA NA PhosphoSitePlus , Unknown S13_VWDHIEVsDDEDETH , S377_TGDEKDVsV , Y298_GLDPVEVyESLPEEL , HTP, in vivo 12930845 , 15082798 , 15592455 , 18669648 , 19413330 , 20068231 ,(Europe PMC )HPRD, PhosphoELM , YES1 Y298_GLDPVEVyESLPEEL , NA NA PhosphoSitePlus ,