Top
BMPR1A
Localization (UniProt annotation) Membrane; Single-pass type I membraneprotein Function (UniProt annotation) On ligand binding, forms a receptor complex consistingof two type II and two type I transmembrane serine/threoninekinases Type II receptors phosphorylate and activate type Ireceptors which autophosphorylate, then bind and activate SMADtranscriptional regulators Receptor for BMP2, BMP4, GDF5 andGDF6 Positively regulates chondrocyte differentiation throughGDF5 interaction Mediates induction of adipogenesis by GDF6 Catalytic Activity (UniProt annotation) ATP + [receptor-protein] = ADP + [receptor-protein] phosphate Protein Sequence MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNG
HCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVLLISM
AVCIIAMIIFSSCFCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDF
LKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNT
RVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLR
PIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) hsa04060 Cytokine-cytokine receptor interaction Cytokines are soluble extracellular proteins or glycoproteins that are crucial intercellular regulators and mobilizers of cells engaged in innate as well as adaptive inflammatory host defenses, cell growth, differentiation, cell death, angiogenesis, and development and repair processes aimed at the restoration of homeostasis. Cytokines are released by various cells in the body, usually in response to an activating stimulus, and they induce responses through binding to specific receptors on the cell surface of target cells. Cytokines can be grouped by structure into different families and their receptors can likewise be grouped. hsa04350 TGF-beta signaling pathway The transforming growth factor-beta (TGF-beta) family members, which include TGF-betas, activins and bone morphogenetic proteins (BMPs), are structurally related secreted cytokines found in species ranging from worms and insects to mammals. A wide spectrum of cellular functions such as proliferation, apoptosis, differentiation and migration are regulated by TGF-beta family members. TGF-beta family member binds to the Type II receptor and recruits Type I, whereby Type II receptor phosphorylates and activates Type I. The Type I receptor, in turn, phosphorylates receptor-activated Smads ( R-Smads: Smad1, Smad2, Smad3, Smad5, and Smad8). Once phosphorylated, R-Smads associate with the co-mediator Smad, Smad4, and the heteromeric complex then translocates into the nucleus. In the nucleus, Smad complexes activate specific genes through cooperative interactions with other DNA-binding and coactivator (or co-repressor) proteins. hsa04390 Hippo signaling pathway Hippo signaling is an evolutionarily conserved signaling pathway that controls organ size from flies to humans. In humans and mice, the pathway consists of the MST1 and MST2 kinases, their cofactor Salvador and LATS1 and LATS2. In response to high cell densities, activated LATS1/2 phosphorylates the transcriptional coactivators YAP and TAZ, promoting its cytoplasmic localization, leading to cell apoptosis and restricting organ size overgrowth. When the Hippo pathway is inactivated at low cell density, YAP/TAZ translocates into the nucleus to bind to the transcription enhancer factor (TEAD/TEF) family of transcriptional factors to promote cell growth and proliferation. YAP/TAZ also interacts with other transcriptional factors or signaling molecules, by which Hippo pathway-mediated processes are interconnected with those of other key signaling cascades, such as those mediated by TGF-beta and Wnt growth factors. hsa04550 Signaling pathways regulating pluripotency of stem cells Pluripotent stem cells (PSCs) are basic cells with an indefinite self-renewal capacity and the potential to generate all the cell types of the three germinal layers. The types of PSCs known to date include embryonic stem (ES) and induced pluripotent stem (iPS) cells. ES cells are derived from the inner cell mass (ICM) of blastocyst-stage embryos. iPS cells are generated by reprogramming somatic cells back to pluripotent state with defined reprogramming factors, Oct4, Sox2, Klf4 and c-Myc (also known as Yamanaka factors). PSCs including ES cells and iPS cells are categorized into two groups by their morphology, gene expression profile and external signal dependence. Conventional mouse-type ES/iPS cells are called 'naive state' cells. They are mainly maintained under the control of LIF and BMP signaling. On the other hand, human-type ES/iPS cells, which are in need of Activin and FGF signaling, are termed 'primed state'. However, these signaling pathways converge towards the activation of a core transcriptional network that is similar in both groups and involves OCt4, Nanog and Sox2. The three transcription factors and their downstream target genes coordinately promote self-renewal and pluripotency. hsa05418 Fluid shear stress and atherosclerosis Shear stress represents the frictional force that the flow of blood exerts at the endothelial surface of the vessel wall and plays a central role in vascular biology and contributes to the progress of atherosclerosis. Sustained laminar flow with high shear stress upregulates expressions of endothelial cell (EC) genes and proteins that are protective against atherosclerosis. The key shear stress-induced transcription factors that govern the expression of these genes are Kruppel-like factor 2 (KLF2) and nuclear factor erythroid 2-like 2 (Nrf2). On the other hand, disturbed flow with associated reciprocating, low shear stress generally upregulates the EC genes and proteins that promote oxidative and inflammatory states in the artery wall, resulting in atherogenesis. Important transcriptional events that reflect this condition of ECs in disturbed flow include the activation of activator protein 1 (AP-1) and nuclear factor kappaB (NF-kappaB).
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-201451 Signaling by BMP. Bone morphogenetic proteins (BMPs) have many biological activities in various tissues, including bone, cartilage, blood vessels, heart, kidney, neurons, liver and lung. They are members of the Transforming growth factor-Beta (TGFB) family. They bind to type II and type I serine-threonine kinase receptors, which transduce signals through SMAD and non-SMAD signalling pathways. BMP signalling is linked to a wide variety of clinical disorders, including vascular diseases, skeletal diseases and cancer. BMPs typically activate BMP type I receptors and signal via SMAD1, 5 and 8. They can be classified into several subgroups, including the BMP2/4 group, the BMP5-8 osteogenic protein-1 (OP1) group, the growth and differentiation factor (GDF) 5-7 group and the BMP9/10 group. Most of the proteins of the BMP2/4, OP1 and BMP9/10 groups induce formation of bone and cartilage tissues in vivo, while the GDF5-7 group induce cartilage and tendon-like, but not bone-like, tissues (Miyazono et al. 2010). Members of the TGFB family bind to two types of serine-threonine kinase receptors, type I and type II (Massagué 2012). BMPs can bind type I receptors in the absence of type II receptors, but both types are required for signal transduction. The presence of both types dramatically increases binding affinity (Rozenweig et al. 1995). The type II receptor kinase transphosphorylates the type I receptor, which transmits specific intracellular signals. Type I and type II receptors share similar structural properties, comprised of a relatively short extracellular domain, a single membrane-spanning domain and an intracellular domain containing a serine-threonine kinase domain. Seven receptors, collectively referred to as the Activin receptor-like kinases (ALK), have been identified as type I receptors for the TGFB family in mammals. ALKs are classified into three groups based on their structure and function, the BMPRI group (Bone morphogenetic protein receptor type-1A, ALK3, BMPR1A and Bone morphogenetic protein receptor type-1B, ALK6, BMPR1B), the ALK1 group (Serine/threonine-protein kinase receptor R3, ALK1, ACVRL1 and Activin receptor type-1, ALK2, ACVR1) and the TBetaR1 group (Activin receptor type-1B, ALK4, ACVR1B and TGF-beta receptor type-1, ALK5, TGFBR1 and Activin receptor type-1C, ALK7, ACVR1C) (Kawabata et al. 1998). ALK1 group and BMPRI group activate SMAD1/5/8 and transduce similar intracellular signals. The TBetaR1 group activate SMAD2/3. BMPR1A and ACVR1 are widely expressed. BMPR1B shows a more restricted expression profile. ACVRL1 is limited to endothelial cells and a few other cell types. The binding specificities of BMPs to type I receptors is affected by the type II receptors that are present (Yu et al. 2005). Typically, BMP2 and BMP4 bind to BMPR1A and BMPR1B (ten Dijke et al. 1994). BMP6 and BMP7 bind strongly to ACVR1 and weakly to BMPR1B. Growth/differentiation factor 5 (BMP14, GDF5) preferentially binds to BMPR1B, but not to other type I receptors (Nishitoh et al. 1995). BMP9 and BMP10 bind to ACVRL1 and ACVRL (Scharpfenecker et al. 2007). BMP type I receptors are shared by other members of the TGFB family. Three receptors, Bone morphogenetic protein receptor type-2 (BMPR2), Activin receptor type-2A (ACVR2A) and Activin receptor type-2B (ACVR2B) are the type II receptors for mammalian BMPs. They are widely expressed in various tissues. BMPR2 is specific for BMPs, whereas ACVR2A and ACVR2B are shared with activins and myostatin. BMP binding and signalling can be affected by coreceptors. Glycosylphosphatidylinositol (GPI)-anchored proteins of the repulsive guidance molecule (RGM) family, including RGMA, RGMB (DRAGON) and Hemojuvelin (HFE2, RGMC) are coreceptors for BMP2 and BMP4, enhancing signaling (Samad et al. 2005, Babitt et al. 2005, 2006). They interact with BMP type I and/or type II receptors and bind BMP2 and BMP4, but not BMP7 or TGFB1. BMP2/4 signalling normally involves BMPR2, not ACVR2A or ACVR2B. Cells transfected with RGMA use both BMPR2 and ACVR2A for BMP-2/4 signalling, suggesting that RGMA facilitates the use of ACVR2A by BMP2/4 (Xia et al. 2007). Endoglin (ENG) is a transmembrane protein expressed in proliferating endothelial cells. It binds various ligands including TGFB1/3, Activin-A and BMP2/7 (Barbara et al. 1999). It inhibits TGFB-induced responses and enhances BMP7-induced responses (Scherner et al. 2007). Mutations in ENG result in hereditary haemorrhagic telangiectasia (HHT1), also known as OslerWeberRendu disease, while mutations in ACVRL1 lead to HHT2, suggesting that they act in a common signalling pathway (McAllister et al. 1994, Johnson et al. 1996). BMP2 is a dimeric protein, having two receptor-binding motifs. One is a high-affinity binding site for BMPR1A, the other is a low-affinity binding site for BMPR2 (Kirsch et al. 2000). In the absence of ligand stimulation, small fractions of type II and type I receptors are present as preexisting homodimers and heterodimers on the cell surface. Ligand-binding increases oligomerization. The intracellular domains of type I receptors have a characteristic GS domain (glycine and serine-rich domain) located N-terminal to the serine-threonine kinase domains. Type II receptor kinases are constitutively active in the absence of ligand. Upon ligand binding, the type II receptor kinase phosphorylates the GS domain of the type I receptor, a critical event in signal transduction by the serine/threonine kinase receptors (Miyazono et al. 2010). Activation of the TGFBR1 receptor has been studied in detail. The inactive conformation is maintained by interaction between the GS domain, the N-terminal lobe and the activation loop of the kinase (Huse et al. 1999). When the GS domain is phosphorylated by the type II receptor kinase, the TGFBR1 kinase is converted to an active conformation. Mutations of Thr-204 in TGFBR1 and the corresponding Gln in BMP type I receptors lead to their constitutive activation. The L45 loop, in the kinase domain of type I receptors, specifically interacts with receptor-regulated Smads (R-Smads). Neurotrophic tyrosine kinase receptor type 3 (NT-3 growth factor receptor, TrkC, NTRK3) directly binds BMPR2, interfereing with its interaction with BMPR1A, which inhibits downstream signalling (Jin et al. 2007). Tyrosine-protein kinase transmembrane receptor ROR2 and BMPR1B form a heteromeric complex in a ligand independent fashion that modulatesGDF5-BMPR1B signalling by inhibition of Smad1/5 signalling (Sammar et al. 2004). Type I receptor kinases activated by the type II receptor kinases, phosphorylate R-Smads. R-Smads then form a complex with common-partner Smad (co-Smad) and translocate to the nucleus. The oligomeric Smad complexes regulate the transcription of target genes through interaction with various transcription factors and transcriptional coactivators or corepressors. Inhibitory Smads (I-Smads) negatively regulate the action of R-Smads and/or co-Smads. Eight different Smads have been identified in mammals. Smad1, Smad5 and Smad8 are R-Smads in BMP signalling pathways (BMP-specific R-Smads). Smad2 and Smad3 are R-Smads in TGFB/activinsignalling pathways. BMP receptors can phosphorylate Smad2 in certain types of cells (Murakami et al. 2009). Smad1, Smad5 and Smad8 are structurally highly similar to each other. The functional differences between them are largely unknown. Smad4 is the only co-Smad in mammals, shared by both BMP and TGFB/activin signalling pathways. Smad6 and Smad7 are I-Smads
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACVR1 Affinity Capture-MS, FRET physical 18436533 , 26186194 , 28514442 , (Europe PMC )NA BioGRID ADGRG5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ARMH4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ARRDC3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BAMBI Reconstituted Complex physical 19758997 , (Europe PMC )NA BioGRID BMP2 Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, competition binding, cross-linking study, enzyme linked immunosorbent assay, light scattering, molecular sieving, surface plasmon resonance, x-ray crystallography direct interaction, physical, physical association 10692589 , 10712517 , 10880444 , 10881198 , 11263668 , 15064755 , 16672363 , 19804412 , 20860622 , 21054789 , 25938661 , (Europe PMC )0.44, 0.97 BioGRID, IntAct, MINT BMP4 Reconstituted Complex, surface plasmon resonance direct interaction, physical, physical association 20860622 , 21054789 , 8006002 , (Europe PMC )0.61 BioGRID, IntAct, MINT BMP6 Affinity Capture-Western physical 10504300 , (Europe PMC )NA BioGRID BMP7 Reconstituted Complex physical 8006002 , (Europe PMC )NA BioGRID BMPR1A Affinity Capture-Western, FRET physical 10712517 , 18436533 , (Europe PMC )NA BioGRID BMPR1B Affinity Capture-Western, Co-localization physical 10712517 , (Europe PMC )NA BioGRID BMPR2 Affinity Capture-Western, Co-localization physical 10712517 , 7791754 , (Europe PMC )NA BioGRID C16orf58 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CAV1 Affinity Capture-Western physical 15657086 , (Europe PMC )NA BioGRID CD83 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CLDND1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FAM171B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FKBP1A Two-hybrid physical 9663660 , (Europe PMC )NA BioGRID FKBP1B Two-hybrid physical 15351706 , (Europe PMC )NA BioGRID FSHR Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FST Co-crystal Structure physical 16198295 , (Europe PMC )NA BioGRID GDF5 Reconstituted Complex, surface plasmon resonance direct interaction, physical 16127465 , 19229295 , 9525338 , (Europe PMC )0.62 BioGRID, IntAct, MINT GDF6 Reconstituted Complex physical 9525338 , (Europe PMC )NA BioGRID GINM1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HAVCR2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HEPACAM2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HSP90AA1 Affinity Capture-Luminescence physical 22939624 , (Europe PMC )NA BioGRID IFNGR1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IGSF1 Affinity Capture-Western physical 11266516 , (Europe PMC )NA BioGRID IL17RB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL1R1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL4R Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LITAF Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LRRIQ1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MANSC1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAS1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MRAP2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MYC Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID NEDD4 Reconstituted Complex physical 19953087 , (Europe PMC )NA BioGRID NEDD4L Biochemical Activity, Reconstituted Complex physical 19953087 , (Europe PMC )NA BioGRID OTUB1 Biochemical Activity physical 25872870 , (Europe PMC )NA BioGRID PDCD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PDGFRB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PEG10 Affinity Capture-Western physical 15611116 , (Europe PMC )NA BioGRID PTGER3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID RGMB Affinity Capture-Western physical 15671031 , (Europe PMC )NA BioGRID RUNX2 Affinity Capture-Western physical 16613856 , (Europe PMC )NA BioGRID SF3B4 Affinity Capture-Western, Two-hybrid physical 15351706 , (Europe PMC )NA BioGRID SLC20A1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SMAD1 Biochemical Activity, two hybrid array physical, physical association 24412244 , 9136927 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMAD6 Affinity Capture-Western physical 20663871 , (Europe PMC )NA BioGRID SMAD7 Affinity Capture-Western physical 15148321 , 20663871 , (Europe PMC )NA BioGRID SMURF1 Affinity Capture-Western physical 12857866 , (Europe PMC )NA BioGRID SNX11 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TGFBR2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TLR2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM52B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TNFRSF10A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TPCN2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TSC22D1 Affinity Capture-Western physical 21791611 , (Europe PMC )NA BioGRID TSPAN17 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID USP15 Affinity Capture-Western, Biochemical Activity, Co-localization physical 24850914 , (Europe PMC )NA BioGRID ZMYND11 Affinity Capture-Western, Two-hybrid physical 9663660 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ALDOB two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT AOPEP two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT BMP2 Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, competition binding, cross-linking study, enzyme linked immunosorbent assay, light scattering, molecular sieving, surface plasmon resonance, x-ray crystallography direct interaction, physical, physical association 10692589 , 10712517 , 10880444 , 10881198 , 11263668 , 15064755 , 16672363 , 19804412 , 20860622 , 21054789 , 25938661 , (Europe PMC )0.44, 0.97 BioGRID, IntAct, MINT BMP4 Reconstituted Complex, surface plasmon resonance direct interaction, physical, physical association 20860622 , 21054789 , 8006002 , (Europe PMC )0.61 BioGRID, IntAct, MINT CDK8 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT CTSV two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT FANCC two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT FBP1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT FBP2 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT FSTL1 surface plasmon resonance direct interaction 20860622 , (Europe PMC )0.44 IntAct, MINT GALNT12 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT GDF5 Reconstituted Complex, surface plasmon resonance direct interaction, physical 16127465 , 19229295 , 9525338 , (Europe PMC )0.62 BioGRID, IntAct, MINT HRAS two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT HSP90AB1 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct IGFBP3 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT MAP2K1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT MSANTD3 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT RASA1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SEC61B two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SFRP2 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SFRP4 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SMAD1 Biochemical Activity, two hybrid array physical, physical association 24412244 , 9136927 , (Europe PMC )0.37 BioGRID, IntAct, MINT TGFB1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT TRMO two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT XPA two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT ZNF189 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ALDOB two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT AOPEP two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT BMP2 Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, competition binding, cross-linking study, enzyme linked immunosorbent assay, light scattering, molecular sieving, surface plasmon resonance, x-ray crystallography direct interaction, physical, physical association 10692589 , 10712517 , 10880444 , 10881198 , 11263668 , 15064755 , 16672363 , 19804412 , 20860622 , 21054789 , 25938661 , (Europe PMC )0.44, 0.97 BioGRID, IntAct, MINT BMP4 Reconstituted Complex, surface plasmon resonance direct interaction, physical, physical association 20860622 , 21054789 , 8006002 , (Europe PMC )0.61 BioGRID, IntAct, MINT CDK8 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT CTSV two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT FANCC two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT FBP1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT FBP2 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT FSTL1 surface plasmon resonance direct interaction 20860622 , (Europe PMC )0.44 IntAct, MINT GALNT12 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT GDF5 Reconstituted Complex, surface plasmon resonance direct interaction, physical 16127465 , 19229295 , 9525338 , (Europe PMC )0.62 BioGRID, IntAct, MINT HRAS two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT IGFBP3 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT MAP2K1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT MSANTD3 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT RASA1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SEC61B two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SFRP2 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SFRP4 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SMAD1 Biochemical Activity, two hybrid array physical, physical association 24412244 , 9136927 , (Europe PMC )0.37 BioGRID, IntAct, MINT TGFB1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT TRMO two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT XPA two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT ZNF189 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACVR1 Affinity Capture-MS, FRET physical 18436533 , 26186194 , 28514442 , (Europe PMC )NA BioGRID ADGRG5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ALDOB two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT AOPEP two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT ARMH4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ARRDC3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BAMBI Reconstituted Complex physical 19758997 , (Europe PMC )NA BioGRID BMP2 Co-crystal Structure, Reconstituted Complex, anti bait coimmunoprecipitation, competition binding, cross-linking study, enzyme linked immunosorbent assay, light scattering, molecular sieving, surface plasmon resonance, x-ray crystallography direct interaction, physical, physical association 10692589 , 10712517 , 10880444 , 10881198 , 11263668 , 15064755 , 16672363 , 19804412 , 20860622 , 21054789 , 25938661 , (Europe PMC )0.44, 0.97 BioGRID, IntAct, MINT BMP4 Reconstituted Complex, surface plasmon resonance direct interaction, physical, physical association 20860622 , 21054789 , 8006002 , (Europe PMC )0.61 BioGRID, IntAct, MINT BMP6 Affinity Capture-Western physical 10504300 , (Europe PMC )NA BioGRID BMP7 Reconstituted Complex physical 8006002 , (Europe PMC )NA BioGRID BMPR1A Affinity Capture-Western, FRET physical 10712517 , 18436533 , (Europe PMC )NA BioGRID BMPR1B Affinity Capture-Western, Co-localization physical 10712517 , (Europe PMC )NA BioGRID BMPR2 Affinity Capture-Western, Co-localization physical 10712517 , 7791754 , (Europe PMC )NA BioGRID C16orf58 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CAV1 Affinity Capture-Western physical 15657086 , (Europe PMC )NA BioGRID CD83 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CDK8 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT CLDND1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CTSV two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT FAM171B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FANCC two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT FBP1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT FBP2 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT FKBP1A Two-hybrid physical 9663660 , (Europe PMC )NA BioGRID FKBP1B Two-hybrid physical 15351706 , (Europe PMC )NA BioGRID FSHR Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FST Co-crystal Structure physical 16198295 , (Europe PMC )NA BioGRID FSTL1 surface plasmon resonance direct interaction 20860622 , (Europe PMC )0.44 IntAct, MINT GALNT12 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT GDF5 Reconstituted Complex, surface plasmon resonance direct interaction, physical 16127465 , 19229295 , 9525338 , (Europe PMC )0.62 BioGRID, IntAct, MINT GDF6 Reconstituted Complex physical 9525338 , (Europe PMC )NA BioGRID GINM1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HAVCR2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HEPACAM2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID HRAS two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT HSP90AA1 Affinity Capture-Luminescence physical 22939624 , (Europe PMC )NA BioGRID HSP90AB1 luminescence based mammalian interactome mapping physical association 22939624 , (Europe PMC )0.40 IntAct IFNGR1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IGFBP3 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT IGSF1 Affinity Capture-Western physical 11266516 , (Europe PMC )NA BioGRID IL17RB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL1R1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID IL4R Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LITAF Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID LRRIQ1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MANSC1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAP2K1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT MAS1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MRAP2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MSANTD3 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT MYC Dosage Lethality genetic 22623531 , (Europe PMC )NA BioGRID NEDD4 Reconstituted Complex physical 19953087 , (Europe PMC )NA BioGRID NEDD4L Biochemical Activity, Reconstituted Complex physical 19953087 , (Europe PMC )NA BioGRID OTUB1 Biochemical Activity physical 25872870 , (Europe PMC )NA BioGRID PDCD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PDGFRB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PEG10 Affinity Capture-Western physical 15611116 , (Europe PMC )NA BioGRID PTGER3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID RASA1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT RGMB Affinity Capture-Western physical 15671031 , (Europe PMC )NA BioGRID RUNX2 Affinity Capture-Western physical 16613856 , (Europe PMC )NA BioGRID SEC61B two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SF3B4 Affinity Capture-Western, Two-hybrid physical 15351706 , (Europe PMC )NA BioGRID SFRP2 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SFRP4 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT SLC20A1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SMAD1 Biochemical Activity, two hybrid array physical, physical association 24412244 , 9136927 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMAD6 Affinity Capture-Western physical 20663871 , (Europe PMC )NA BioGRID SMAD7 Affinity Capture-Western physical 15148321 , 20663871 , (Europe PMC )NA BioGRID SMURF1 Affinity Capture-Western physical 12857866 , (Europe PMC )NA BioGRID SNX11 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TGFB1 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT TGFBR2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TLR2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TMEM52B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TNFRSF10A Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TPCN2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRMO two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT TSC22D1 Affinity Capture-Western physical 21791611 , (Europe PMC )NA BioGRID TSPAN17 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID USP15 Affinity Capture-Western, Biochemical Activity, Co-localization physical 24850914 , (Europe PMC )NA BioGRID XPA two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT ZMYND11 Affinity Capture-Western, Two-hybrid physical 9663660 , (Europe PMC )NA BioGRID ZNF189 two hybrid array physical association 24412244 , (Europe PMC )0.37 IntAct, MINT