Top
BCAR1
Localization (UniProt annotation) Cell junction, focal adhesion Cytoplasm Note=Unphosphorylated formlocalizes in the cytoplasm and can move to the membrane upontyrosine phosphorylation Function (UniProt annotation) Docking protein which plays a central coordinating rolefor tyrosine kinase-based signaling related to cell adhesionImplicated in induction of cell migration Overexpression confersantiestrogen resistance on breast cancer cells Catalytic Activity (UniProt annotation) N/A Protein Sequence MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKPAGPGPGPPA
TPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPSP
ATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHL
LAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPSNHHAVYDVPPSVSKDVPDGP
LLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVA
DGGVVDSGVYAVPPPAEREAPAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDL
AGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQ
ALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSP
PKFTSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLA
NWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLS
RQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAA
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
BCAR1 is dephosphorylated by following phosphatases:
Phosphatase Gene Name Phosphatase UniProt_AC DephosphoSite and sequence (+/-5) in BCAR1 (P56945) Bioassay Type PubMed ID View in Europe PMC Reliability of the interaction PTPN12 Q05209 NA In vitro and in vivo 9285683 , 12714323 , 9748319 , 8887669 , 9920935 , Europe PMC PTPRA P18433 NA In vitro and in vivo 10787408 , Europe PMC PTPRH Q9HD43 NA In vitro and in vivo 11278335 , Europe PMC PPP2CA P67775 NA In vitro 11593413 , Europe PMC PPP2CB P62714 NA In vitro 11593413 , Europe PMC PTP4A3 O75365 NA In vivo 11355880 , Europe PMC PTPN1 P18031 NA In vivo 8940134 , 9418872 , Europe PMC
Pathway ID Pathway Name Pathway Description (KEGG) hsa04015 Rap1 signaling pathway Rap1 is a small GTPase that controls diverse processes, such as cell adhesion, cell-cell junction formation and cell polarity. Like all G proteins, Rap1 cycles between an inactive GDP-bound and an active GTP-bound conformation. A variety of extracellular signals control this cycle through the regulation of several unique guanine nucleotide exchange factors (GEFs) and GTPase activating proteins (GAPs). Rap1 plays a dominant role in the control of cell-cell and cell-matrix interactions by regulating the function of integrins and other adhesion molecules in various cell types. Rap1 also regulates MAP kinase (MAPK) activity in a manner highly dependent on the context of cell types. hsa04062 Chemokine signaling pathway Inflammatory immune response requires the recruitment of leukocytes to the site of inflammation upon foreign insult. Chemokines are small chemoattractant peptides that provide directional cues for the cell trafficking and thus are vital for protective host response. In addition, chemokines regulate plethora of biological processes of hematopoietic cells to lead cellular activation, differentiation and survival.The chemokine signal is transduced by chemokine receptors (G-protein coupled receptors) expressed on the immune cells. After receptor activation, the alpha- and beta-gamma-subunits of G protein dissociate to activate diverse downstream pathways resulting in cellular polarization and actin reorganization. Various members of small GTPases are involved in this process. Induction of nitric oxide and production of reactive oxygen species are as well regulated by chemokine signal via calcium mobilization and diacylglycerol production. hsa04510 Focal adhesion Cell-matrix adhesions play essential roles in important biological processes including cell motility, cell proliferation, cell differentiation, regulation of gene expression and cell survival. At the cell-extracellular matrix contact points, specialized structures are formed and termed focal adhesions, where bundles of actin filaments are anchored to transmembrane receptors of the integrin family through a multi-molecular complex of junctional plaque proteins. Some of the constituents of focal adhesions participate in the structural link between membrane receptors and the actin cytoskeleton, while others are signalling molecules, including different protein kinases and phosphatases, their substrates, and various adapter proteins. Integrin signaling is dependent upon the non-receptor tyrosine kinase activities of the FAK and src proteins as well as the adaptor protein functions of FAK, src and Shc to initiate downstream signaling events. These signalling events culminate in reorganization of the actin cytoskeleton; a prerequisite for changes in cell shape and motility, and gene expression. Similar morphological alterations and modulation of gene expression are initiated by the binding of growth factors to their respective receptors, emphasizing the considerable crosstalk between adhesion- and growth factor-mediated signalling. hsa04670 Leukocyte transendothelial migration Leukocyte migaration from the blood into tissues is vital for immune surveillance and inflammation. During this diapedesis of leukocytes, the leukocytes bind to endothelial cell adhesion molecules (CAM) and then migrate across the vascular endothelium. A leukocyte adherent to CAMs on the endothelial cells moves forward by leading-edge protrusion and retraction of its tail. In this process, alphaL /beta2 integrin activates through Vav1, RhoA, which subsequently activates the kinase p160ROCK. ROCK activation leads to MLC phosphorylation, resulting in retraction of the actin cytoskeleton. Moreover, Leukocytes activate endothelial cell signals that stimulate endothelial cell retraction during localized dissociation of the endothelial cell junctions. ICAM-1-mediated signals activate an endothelial cell calcium flux and PKC, which are required for ICAM-1 dependent leukocyte migration. VCAM-1 is involved in the opening of the endothelial passagethrough which leukocytes can extravasate. In this regard, VCAM-1 ligation induces NADPH oxidase activation and the production of reactive oxygen species (ROS) in a Rac-mediated manner, with subsequent activation of matrix metallopoteinases and loss of VE-cadherin-mediated adhesion. hsa04810 Regulation of actin cytoskeleton hsa05100 Bacterial invasion of epithelial cells Many pathogenic bacteria can invade phagocytic and non-phagocytic cells and colonize them intracellularly, then become disseminated to other cells. Invasive bacteria induce their own uptake by non-phagocytic host cells (e.g. epithelial cells) using two mechanisms referred to as zipper model and trigger model. Listeria, Staphylococcus, Streptococcus, and Yersinia are examples of bacteria that enter using the zipper model. These bacteria express proteins on their surfaces that interact with cellular receptors, initiating signalling cascades that result in close apposition of the cellular membrane around the entering bacteria. Shigella and Salmonella are the examples of bacteria entering cells using the trigger model. These bacteria use type III secretion systems to inject protein effectors that interact with the actin cytoskeleton. hsa05163 Human cytomegalovirus infection Human cytomegalovirus (HCMV) is an enveloped, double-stranded DNA virus that is a member of beta-herpesvirus family. HCMV is best known for causing significant morbidity and mortality in immunocompromised populations. As with other herpesviruses, HCMV gB and gH/gL envelope glycoproteins are essential for virus entry. HCMV gB could activate the PDGFRA, and induce activation of the oncogenic PI3-K/AKT pathway. Though it is unlikely that HCMV by itself can act as an oncogenic factor, HCMV may have an oncomodulatory role, to catalyze an oncogenic process that has already been initiated. US28, one of the four HCMV-encoded vGPCRs (US27, US28, UL33 and UL78), also has a specific role in the oncomodulatory properties. In addition, HCMV has developed numerous mechanisms for manipulating the host immune system. The virally encoded US2, US3, US6 and US11 gene products all interfere with major histocompatibility complex (MHC) class I antigen presentation. HCMV encodes several immediate early (IE) antiapoptotic proteins (IE1, IE2, vMIA and vICA). These proteins might avoid immune clearance of infected tumor cells by cytotoxic lymphocytes and NK cells.
Pathway ID Pathway Name Pathway Description (KEGG) R-HSA-186763 Downstream signal transduction. The role of autophosphorylation sites on PDGF receptors are to provide docking sites for downstream signal transduction molecules which contain SH2 domains. The SH2 domain is a conserved motif of around 100 amino acids that can bind a phosphorylated tyrosine residue. These downstream molecules are activated upon binding to, or phosphorylated by, the receptor kinases intrinsic to PDGF receptors.Some of the dowstream molecules are themselves enzymes, such as phosphatidylinositol 3'-kinase (PI3K), phospholipase C (PLC-gamma), the Src family of tyrosine kinases, the tyrosine phosphatase SHP2, and a GTPase activating protein (GAP) for Ras. Others such as Grb2 are adaptor molecules which link the receptor with downstream catalytic molecules R-HSA-372708 p130Cas linkage to MAPK signaling for integrins. Integrin signaling is linked to the MAP kinase pathway by recruiting p130cas and Crk to the FAK/Src activation complex R-HSA-4420097 VEGFA-VEGFR2 Pathway. Angiogenesis is the formation of new blood vessels from preexisting vasculature. One of the most important proangiogenic factors is vascular endothelial growth factor (VEGF). VEGF exerts its biologic effect through interaction with transmembrane tyrosine kinase receptors VEGFR, selectively expressed on vascular endothelial cells. VEGFA signaling through VEGFR2 is the major pathway that activates angiogenesis by inducing the proliferation, survival, sprouting and migration of endothelial cells (ECs), and also by increasing endothelial permeability (Lohela et al. 2009, Shibuya & Claesson-Welsh 2006, Claesson-Welsh & Welsh, 2013). The critical role of VEGFR2 in vascular development is highlighted by the fact that VEGFR2-/- mice die at E8.5-9.5 due to defective development of blood islands, endothelial cells and haematopoietic cells (Shalaby et al. 1995) R-HSA-8849471 PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases. PTK6 promotes cell motility and migration by regulating the activity of RHO GTPases RAC1 (Chen et al. 2004) and RHOA (Shen et al. 2008). PTK6 inhibits RAS GTPase activating protein RASA1 (Shen et al. 2008) and may be involved in MAPK7 (ERK5) activation (Ostrander et al. 2007, Zheng et al
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABL1 Affinity Capture-Western, Biochemical Activity physical 7780740 , 8810278 , (Europe PMC )NA BioGRID ALK Affinity Capture-MS, Affinity Capture-Western physical 16105984 , (Europe PMC )NA BioGRID ARHGAP32 Affinity Capture-Western, Reconstituted Complex physical 12446789 , 12819203 , (Europe PMC )NA BioGRID ARMCX3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID BCAR3 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, isothermal titration calorimetry, molecular sieving direct interaction, physical, physical association 12517963 , 22081014 , 28514442 , (Europe PMC )0.61 BioGRID, IntAct BMX Protein-peptide physical 22974441 , (Europe PMC )NA BioGRID CBL Affinity Capture-Western physical 8683103 , (Europe PMC )NA BioGRID CD2AP Affinity Capture-Western, Reconstituted Complex physical 10339567 , 12618476 , (Europe PMC )NA BioGRID CDC42 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17038317 , (Europe PMC )0.40 BioGRID, IntAct, MINT CRK Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10085298 , 10329689 , 10464310 , 10747099 , 10753828 , 11278916 , 11369773 , 11839772 , 12615911 , 12799422 , 14657239 , 15492270 , 15673687 , 16267043 , 17038317 , 18835194 , 19380743 , 22974441 , 9581808 , 9920935 , (Europe PMC )0.76 BioGRID, IntAct, MINT CRKL Affinity Capture-Western, Far Western, Protein-peptide, pull down association, physical 18835194 , 22974441 , 23770091 , 8810278 , 9498705 , (Europe PMC )0.35 BioGRID, IntAct, MINT DOCK1 Affinity Capture-Western, Reconstituted Complex physical 12615911 , (Europe PMC )NA BioGRID E2F2 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct EFS Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct EPN1 Co-fractionation, anti bait coimmunoprecipitation association, physical 22863883 , 28007913 , (Europe PMC )0.35 BioGRID, IntAct ERBB2 Affinity Capture-Western physical 26716506 , (Europe PMC )NA BioGRID ESR1 Affinity Capture-Western physical 15020686 , 19331827 , (Europe PMC )NA BioGRID FXYD6 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct FYN Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, peptide array, pull down, two hybrid array, two hybrid prey pooling approach association, physical, physical association 10739664 , 17474147 , 9188452 , 9360983 , (Europe PMC )0.49, 0.62 BioGRID, IntAct, MINT GMPR2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-Western, Reconstituted Complex physical 10085298 , 10822386 , 16105984 , (Europe PMC )NA BioGRID HCK Reconstituted Complex physical 9020138 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID HSPA5 Two-hybrid physical 16169070 , (Europe PMC )NA BioGRID HYOU1 Co-fractionation, anti bait coimmunoprecipitation association, physical 22863883 , 28007913 , (Europe PMC )0.35 BioGRID, IntAct ID2 Affinity Capture-Western physical 10502414 , (Europe PMC )NA BioGRID INPPL1 Affinity Capture-Western, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 11158326 , (Europe PMC )0.40 BioGRID, IntAct ITGAV Affinity Capture-Western physical 16600665 , (Europe PMC )NA BioGRID KIF13A Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID LCK Reconstituted Complex physical 9020138 , (Europe PMC )NA BioGRID LYN Affinity Capture-Western physical 9020138 , 9581808 , (Europe PMC )NA BioGRID MAPK14 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MAPK8 Affinity Capture-Western physical 11432831 , (Europe PMC )NA BioGRID MMP14 Affinity Capture-Western, anti bait coimmunoprecipitation, fluorescence microscopy colocalization, physical, physical association 18164686 , (Europe PMC )0.46 BioGRID, IntAct, MINT NCK1 Affinity Capture-Western, Protein-peptide physical 12135674 , 22974441 , (Europe PMC )NA BioGRID NEDD9 Affinity Capture-Western physical 10502414 , (Europe PMC )NA BioGRID NPHP1 Affinity Capture-Western, Two-hybrid physical 10739664 , 11493697 , 18477472 , (Europe PMC )NA BioGRID PIK3R1 Affinity Capture-Western, Reconstituted Complex physical 10799562 , (Europe PMC )NA BioGRID PPP1R15A Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PTEN Reconstituted Complex physical 9927060 , (Europe PMC )NA BioGRID PTK2 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, filter binding physical, physical association 10753828 , 11577104 , 11839772 , 12135674 , 12615911 , 15673687 , 21034468 , 21855630 , 8649427 , 8810278 , 9285683 , (Europe PMC )0.59 BioGRID, IntAct, MINT PTK2B Affinity Capture-Western, Two-hybrid physical 11036077 , 12893833 , 8995252 , 9020138 , (Europe PMC )NA BioGRID PTPN1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, phosphatase assay association, dephosphorylation reaction, direct interaction, physical, physical association 10889023 , 15866871 , 8940134 , 9407132 , 9418872 , (Europe PMC )0.79 BioGRID, IntAct, MINT PTPN11 Affinity Capture-Western physical 9188452 , (Europe PMC )NA BioGRID PTPN12 Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex, affinity chromatography technology, pull down direct interaction, physical, physical association 12714323 , 27880917 , 8887669 , 9285683 , 9748319 , (Europe PMC )0.60 BioGRID, IntAct, MINT PTPRH Reconstituted Complex physical 11278335 , (Europe PMC )NA BioGRID PXN Affinity Capture-Western physical 11577104 , 8810278 , (Europe PMC )NA BioGRID RAN Two-hybrid physical 11032817 , (Europe PMC )NA BioGRID RAPGEF1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 9748234 , (Europe PMC )NA BioGRID SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SH2D3A Affinity Capture-Western physical 10187783 , (Europe PMC )NA BioGRID SH2D3C Affinity Capture-Western, anti bait coimmunoprecipitation, cosedimentation in solution, ion exchange chromatography, molecular sieving, pull down, x-ray crystallography direct interaction, physical, physical association 10692442 , 22081014 , (Europe PMC )0.69 BioGRID, IntAct SH3KBP1 Affinity Capture-Western physical 11071869 , 12618476 , (Europe PMC )NA BioGRID SRC Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, fluorescence technology, pull down association, physical, physical association 10085298 , 10487518 , 10542110 , 10739664 , 11514617 , 12397603 , 12615911 , 15020686 , 16849545 , 17038317 , 17129785 , 21034468 , (Europe PMC )0.69 BioGRID, IntAct, MINT SRCIN1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 14657239 , (Europe PMC )0.46 BioGRID, IntAct TNK2 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down physical, physical association 17038317 , (Europe PMC )0.52 BioGRID, IntAct, MINT TNS1 Affinity Capture-Western physical 8810278 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRIP6 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 11782456 , 14688263 , (Europe PMC )0.40 BioGRID, IntAct TSEN34 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TSG101 Affinity Capture-Western, Co-localization physical 27764233 , (Europe PMC )NA BioGRID UHRF2 Far Western, antibody array physical, physical association 21952639 , (Europe PMC )0.40 BioGRID, IntAct VCL Affinity Capture-Western, two hybrid array, two hybrid prey pooling approach physical, physical association 11577104 , (Europe PMC )0.49 BioGRID, IntAct VPS11 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct YWHAE Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17979178 , 28007913 , (Europe PMC )0.35 BioGRID, IntAct YWHAZ Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10026197 , (Europe PMC )NA BioGRID ZYX Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 11782456 , (Europe PMC )0.40 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCF2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ACOT9 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ACTB fluorescence microscopy colocalization 18164686 , (Europe PMC )0.27 IntAct, MINT ACTG1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ACTN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ADD3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct AFDN anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct AGO1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct AGO2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct AGO3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct AGO4 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct AKAP2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ALB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ALDOA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ANXA1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct AP2S1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ARF4 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ARHGEF11 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ARMCX1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ARPC5L anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ASCC3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ATP6V0D1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ATP6V1E1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct BCAR3 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, isothermal titration calorimetry, molecular sieving direct interaction, physical, physical association 12517963 , 22081014 , 28514442 , (Europe PMC )0.61 BioGRID, IntAct BSG anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CACNA2D1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CALD1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CALR anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CALU anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CAPN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CAPZB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CCDC124 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CCT7 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CDC42 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17038317 , (Europe PMC )0.40 BioGRID, IntAct, MINT CDC42BPB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CDK11A anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CEP290 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CETN2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CGNL1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CLIC1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CNP anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct COPG1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CRIP2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CRK Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10085298 , 10329689 , 10464310 , 10747099 , 10753828 , 11278916 , 11369773 , 11839772 , 12615911 , 12799422 , 14657239 , 15492270 , 15673687 , 16267043 , 17038317 , 18835194 , 19380743 , 22974441 , 9581808 , 9920935 , (Europe PMC )0.76 BioGRID, IntAct, MINT CRKL Affinity Capture-Western, Far Western, Protein-peptide, pull down association, physical 18835194 , 22974441 , 23770091 , 8810278 , 9498705 , (Europe PMC )0.35 BioGRID, IntAct, MINT CSRP1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CSRP2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CTSB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CTTN anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CYR61 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct DECR1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct DHX29 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct DHX36 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct DNAJA1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct DNAJB4 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct DPM1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct DSC1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct E2F2 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct EDF1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EFS Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct EGFR anti bait coimmunoprecipitation association 15657067 , (Europe PMC )0.35 IntAct EIF3D anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EIF3F anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EIF3H anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EIF4G1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EIF4G2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ELOC anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EPB41 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EPN1 Co-fractionation, anti bait coimmunoprecipitation association, physical 22863883 , 28007913 , (Europe PMC )0.35 BioGRID, IntAct EPRS anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ETF1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EWSR1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FAM120A anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FARSB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FGD5 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FHOD1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FKBP3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FLII anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FLNB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FMNL3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FSCN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FXR2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FXYD6 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct FYN Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, peptide array, pull down, two hybrid array, two hybrid prey pooling approach association, physical, physical association 10739664 , 17474147 , 9188452 , 9360983 , (Europe PMC )0.49, 0.62 BioGRID, IntAct, MINT GAK anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct GAPDH anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct GIGYF2 {ECO:0000303|PubMed:12771153, anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct GLUD1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct GLUD2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct GRSF1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct HBB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct HBD anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct HMGB1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct HSP90AA1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct HSP90AB2P anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct HSPA5 two hybrid pooling approach physical association 16169070 , (Europe PMC )0.37 IntAct HTRA1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct HYOU1 Co-fractionation, anti bait coimmunoprecipitation association, physical 22863883 , 28007913 , (Europe PMC )0.35 BioGRID, IntAct IDH2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct INPP5K anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct INPPL1 Affinity Capture-Western, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 11158326 , (Europe PMC )0.40 BioGRID, IntAct IQGAP1 anti bait coimmunoprecipitation, pull down association, physical association 28007913 , (Europe PMC )0.58 IntAct KANK1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct KATNAL2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct KCTD12 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct KIF1A anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct KIF1B anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct KIF1C anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct KRBA2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct LDHA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct LEMD2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct LMAN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct LRRC59 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct LRRFIP2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct LUC7L anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MACF1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MAPK14 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MARCKSL1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MICAL2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MMP14 Affinity Capture-Western, anti bait coimmunoprecipitation, fluorescence microscopy colocalization, physical, physical association 18164686 , (Europe PMC )0.46 BioGRID, IntAct, MINT MOV10 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MPRIP anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MYH11 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MYO18A anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MYO1C anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MYO6 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct NAP1L1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct NAPA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct NAPB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct NCL anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct NEXN anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct NPHP4 anti tag coimmunoprecipitation association 15661758 , (Europe PMC )0.35 IntAct NUMB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct OCRL anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct P4HA2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct P4HB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PA2G4 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PABPC1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PABPC3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PBXIP1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PDE4DIP anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PDIA6 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PEAK1 anti tag coimmunoprecipitation association, physical association 20534451 , (Europe PMC )0.50 IntAct PFN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PGD anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PGK1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PLOD3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PNPT1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PPM1G anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PPP1CA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PPP1R15A Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PPP1R18 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PPP2CA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PPP2CB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PRDX2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PRDX6 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PRKRA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PRRC2C anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PSMD11 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PSMD4 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PTK2 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, filter binding physical, physical association 10753828 , 11577104 , 11839772 , 12135674 , 12615911 , 15673687 , 21034468 , 21855630 , 8649427 , 8810278 , 9285683 , (Europe PMC )0.59 BioGRID, IntAct, MINT PTMA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PTPN1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, phosphatase assay association, dephosphorylation reaction, direct interaction, physical, physical association 10889023 , 15866871 , 8940134 , 9407132 , 9418872 , (Europe PMC )0.79 BioGRID, IntAct, MINT PTPN12 Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex, affinity chromatography technology, pull down direct interaction, physical, physical association 12714323 , 27880917 , 8887669 , 9285683 , 9748319 , (Europe PMC )0.60 BioGRID, IntAct, MINT PTPN14 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct QKI anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RAI14 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RBM39 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RCN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RDX anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL10A anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL13A anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL18A anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL26 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL27 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL39 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL39P5 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL5 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL7 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPLP2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPS11 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPS17 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPS6 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SAMD9L anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SARS anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SET anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SH2D3C Affinity Capture-Western, anti bait coimmunoprecipitation, cosedimentation in solution, ion exchange chromatography, molecular sieving, pull down, x-ray crystallography direct interaction, physical, physical association 10692442 , 22081014 , (Europe PMC )0.69 BioGRID, IntAct SH3BGRL3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SHROOM2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SIPA1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SLC25A11 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SLFN5 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SND1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SNX18 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SPIRE1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SPTAN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SPTBN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SRC Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, fluorescence technology, pull down association, physical, physical association 10085298 , 10487518 , 10542110 , 10739664 , 11514617 , 12397603 , 12615911 , 15020686 , 16849545 , 17038317 , 17129785 , 21034468 , (Europe PMC )0.69 BioGRID, IntAct, MINT SRCIN1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 14657239 , (Europe PMC )0.46 BioGRID, IntAct SRGAP1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SRP54 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SRPK1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SRPK2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SRPK3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SSR3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SSR4 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct STIP1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SYNE2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SYNJ1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TAOK2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TBCA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TFAM anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TFCP2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TJP1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TKT anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TMOD1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TMOD3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TMSB10 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TMSB4X anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TNK2 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down physical, physical association 17038317 , (Europe PMC )0.52 BioGRID, IntAct, MINT TNS3 anti bait coimmunoprecipitation, fluorescence microscopy, pull down colocalization, physical association 19732724 , (Europe PMC )0.56 IntAct TPM3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TPP1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TRIOBP anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TRIP4 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TRIP6 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 11782456 , 14688263 , (Europe PMC )0.40 BioGRID, IntAct TUBA1C anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TUBA4A two hybrid pooling approach physical association 16169070 , (Europe PMC )0.37 IntAct TUBB8 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TXNDC5 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct UACA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct UBAP2L anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct UBP1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct UHRF2 Far Western, antibody array physical, physical association 21952639 , (Europe PMC )0.40 BioGRID, IntAct UPF1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct USP10 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct VCL Affinity Capture-Western, two hybrid array, two hybrid prey pooling approach physical, physical association 11577104 , (Europe PMC )0.49 BioGRID, IntAct VPS11 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct VPS39 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct YWHAE Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17979178 , 28007913 , (Europe PMC )0.35 BioGRID, IntAct YWHAH tandem affinity purification association 17979178 , (Europe PMC )0.35 IntAct ZC3H15 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ZYX Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 11782456 , (Europe PMC )0.40 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACTB fluorescence microscopy colocalization 18164686 , (Europe PMC )0.27 IntAct, MINT CDC42 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17038317 , (Europe PMC )0.40 BioGRID, IntAct, MINT CRK Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10085298 , 10329689 , 10464310 , 10747099 , 10753828 , 11278916 , 11369773 , 11839772 , 12615911 , 12799422 , 14657239 , 15492270 , 15673687 , 16267043 , 17038317 , 18835194 , 19380743 , 22974441 , 9581808 , 9920935 , (Europe PMC )0.76 BioGRID, IntAct, MINT CRKL Affinity Capture-Western, Far Western, Protein-peptide, pull down association, physical 18835194 , 22974441 , 23770091 , 8810278 , 9498705 , (Europe PMC )0.35 BioGRID, IntAct, MINT FYN Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, peptide array, pull down, two hybrid array, two hybrid prey pooling approach association, physical, physical association 10739664 , 17474147 , 9188452 , 9360983 , (Europe PMC )0.49, 0.62 BioGRID, IntAct, MINT MMP14 Affinity Capture-Western, anti bait coimmunoprecipitation, fluorescence microscopy colocalization, physical, physical association 18164686 , (Europe PMC )0.46 BioGRID, IntAct, MINT PTK2 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, filter binding physical, physical association 10753828 , 11577104 , 11839772 , 12135674 , 12615911 , 15673687 , 21034468 , 21855630 , 8649427 , 8810278 , 9285683 , (Europe PMC )0.59 BioGRID, IntAct, MINT PTPN1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, phosphatase assay association, dephosphorylation reaction, direct interaction, physical, physical association 10889023 , 15866871 , 8940134 , 9407132 , 9418872 , (Europe PMC )0.79 BioGRID, IntAct, MINT PTPN12 Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex, affinity chromatography technology, pull down direct interaction, physical, physical association 12714323 , 27880917 , 8887669 , 9285683 , 9748319 , (Europe PMC )0.60 BioGRID, IntAct, MINT SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SRC Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, fluorescence technology, pull down association, physical, physical association 10085298 , 10487518 , 10542110 , 10739664 , 11514617 , 12397603 , 12615911 , 15020686 , 16849545 , 17038317 , 17129785 , 21034468 , (Europe PMC )0.69 BioGRID, IntAct, MINT TNK2 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down physical, physical association 17038317 , (Europe PMC )0.52 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABCF2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ABL1 Affinity Capture-Western, Biochemical Activity physical 7780740 , 8810278 , (Europe PMC )NA BioGRID ACOT9 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ACTB fluorescence microscopy colocalization 18164686 , (Europe PMC )0.27 IntAct, MINT ACTG1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ACTN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ADD3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct AFDN anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct AGO1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct AGO2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct AGO3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct AGO4 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct AKAP2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ALB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ALDOA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ALK Affinity Capture-MS, Affinity Capture-Western physical 16105984 , (Europe PMC )NA BioGRID ANXA1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct AP2S1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ARF4 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ARHGAP32 Affinity Capture-Western, Reconstituted Complex physical 12446789 , 12819203 , (Europe PMC )NA BioGRID ARHGEF11 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ARMCX1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ARMCX3 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID ARPC5L anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ASCC3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ATP6V0D1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ATP6V1E1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct BCAR3 Affinity Capture-MS, Affinity Capture-Western, anti bait coimmunoprecipitation, isothermal titration calorimetry, molecular sieving direct interaction, physical, physical association 12517963 , 22081014 , 28514442 , (Europe PMC )0.61 BioGRID, IntAct BMX Protein-peptide physical 22974441 , (Europe PMC )NA BioGRID BSG anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CACNA2D1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CALD1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CALR anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CALU anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CAPN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CAPZB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CBL Affinity Capture-Western physical 8683103 , (Europe PMC )NA BioGRID CCDC124 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CCT7 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CD2AP Affinity Capture-Western, Reconstituted Complex physical 10339567 , 12618476 , (Europe PMC )NA BioGRID CDC42 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 17038317 , (Europe PMC )0.40 BioGRID, IntAct, MINT CDC42BPB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CDK11A anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CEP290 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CETN2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CGNL1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CLIC1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CNP anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct COPG1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CRIP2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CRK Affinity Capture-MS, Affinity Capture-Western, Protein-peptide, Reconstituted Complex, anti bait coimmunoprecipitation, pull down association, physical, physical association 10085298 , 10329689 , 10464310 , 10747099 , 10753828 , 11278916 , 11369773 , 11839772 , 12615911 , 12799422 , 14657239 , 15492270 , 15673687 , 16267043 , 17038317 , 18835194 , 19380743 , 22974441 , 9581808 , 9920935 , (Europe PMC )0.76 BioGRID, IntAct, MINT CRKL Affinity Capture-Western, Far Western, Protein-peptide, pull down association, physical 18835194 , 22974441 , 23770091 , 8810278 , 9498705 , (Europe PMC )0.35 BioGRID, IntAct, MINT CSRP1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CSRP2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CTSB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CTTN anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct CYR61 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct DECR1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct DHX29 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct DHX36 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct DNAJA1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct DNAJB4 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct DOCK1 Affinity Capture-Western, Reconstituted Complex physical 12615911 , (Europe PMC )NA BioGRID DPM1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct DSC1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct E2F2 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct EDF1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EFS Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct EGFR anti bait coimmunoprecipitation association 15657067 , (Europe PMC )0.35 IntAct EIF3D anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EIF3F anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EIF3H anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EIF4G1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EIF4G2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ELOC anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EPB41 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EPN1 Co-fractionation, anti bait coimmunoprecipitation association, physical 22863883 , 28007913 , (Europe PMC )0.35 BioGRID, IntAct EPRS anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ERBB2 Affinity Capture-Western physical 26716506 , (Europe PMC )NA BioGRID ESR1 Affinity Capture-Western physical 15020686 , 19331827 , (Europe PMC )NA BioGRID ETF1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct EWSR1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FAM120A anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FARSB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FGD5 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FHOD1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FKBP3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FLII anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FLNB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FMNL3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FSCN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FXR2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct FXYD6 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct FYN Affinity Capture-Western, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, peptide array, pull down, two hybrid array, two hybrid prey pooling approach association, physical, physical association 10739664 , 17474147 , 9188452 , 9360983 , (Europe PMC )0.49, 0.62 BioGRID, IntAct, MINT GAK anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct GAPDH anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct GIGYF2 {ECO:0000303|PubMed:12771153, anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct GLUD1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct GLUD2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct GMPR2 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID GRB2 Affinity Capture-Western, Reconstituted Complex physical 10085298 , 10822386 , 16105984 , (Europe PMC )NA BioGRID GRSF1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct HBB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct HBD anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct HCK Reconstituted Complex physical 9020138 , (Europe PMC )NA BioGRID HMGB1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID HSP90AA1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct HSP90AB2P anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct HSPA5 Two-hybrid physical 16169070 , (Europe PMC )NA BioGRID HSPA5 two hybrid pooling approach physical association 16169070 , (Europe PMC )0.37 IntAct HTRA1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct HYOU1 Co-fractionation, anti bait coimmunoprecipitation association, physical 22863883 , 28007913 , (Europe PMC )0.35 BioGRID, IntAct ID2 Affinity Capture-Western physical 10502414 , (Europe PMC )NA BioGRID IDH2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct INPP5K anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct INPPL1 Affinity Capture-Western, Far Western, Reconstituted Complex, anti bait coimmunoprecipitation physical, physical association 11158326 , (Europe PMC )0.40 BioGRID, IntAct IQGAP1 anti bait coimmunoprecipitation, pull down association, physical association 28007913 , (Europe PMC )0.58 IntAct ITGAV Affinity Capture-Western physical 16600665 , (Europe PMC )NA BioGRID KANK1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct KATNAL2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct KCTD12 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct KIF13A Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID KIF1A anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct KIF1B anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct KIF1C anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct KRBA2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct LCK Reconstituted Complex physical 9020138 , (Europe PMC )NA BioGRID LDHA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct LEMD2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct LMAN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct LRRC59 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct LRRFIP2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct LUC7L anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct LYN Affinity Capture-Western physical 9020138 , 9581808 , (Europe PMC )NA BioGRID MACF1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MAPK14 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct MAPK8 Affinity Capture-Western physical 11432831 , (Europe PMC )NA BioGRID MARCKSL1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MICAL2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MMP14 Affinity Capture-Western, anti bait coimmunoprecipitation, fluorescence microscopy colocalization, physical, physical association 18164686 , (Europe PMC )0.46 BioGRID, IntAct, MINT MOV10 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MPRIP anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MYH11 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MYO18A anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MYO1C anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct MYO6 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct NAP1L1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct NAPA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct NAPB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct NCK1 Affinity Capture-Western, Protein-peptide physical 12135674 , 22974441 , (Europe PMC )NA BioGRID NCL anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct NEDD9 Affinity Capture-Western physical 10502414 , (Europe PMC )NA BioGRID NEXN anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct NPHP1 Affinity Capture-Western, Two-hybrid physical 10739664 , 11493697 , 18477472 , (Europe PMC )NA BioGRID NPHP4 anti tag coimmunoprecipitation association 15661758 , (Europe PMC )0.35 IntAct NUMB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct OCRL anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct P4HA2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct P4HB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PA2G4 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PABPC1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PABPC3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PBXIP1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PDE4DIP anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PDIA6 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PEAK1 anti tag coimmunoprecipitation association, physical association 20534451 , (Europe PMC )0.50 IntAct PFN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PGD anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PGK1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PIK3R1 Affinity Capture-Western, Reconstituted Complex physical 10799562 , (Europe PMC )NA BioGRID PLOD3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PNPT1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PPM1G anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PPP1CA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PPP1R15A Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PPP1R18 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PPP2CA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PPP2CB anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PRDX2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PRDX6 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PRKRA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PRRC2C anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PSMD11 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PSMD4 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PTEN Reconstituted Complex physical 9927060 , (Europe PMC )NA BioGRID PTK2 Affinity Capture-Western, Reconstituted Complex, coimmunoprecipitation, filter binding physical, physical association 10753828 , 11577104 , 11839772 , 12135674 , 12615911 , 15673687 , 21034468 , 21855630 , 8649427 , 8810278 , 9285683 , (Europe PMC )0.59 BioGRID, IntAct, MINT PTK2B Affinity Capture-Western, Two-hybrid physical 11036077 , 12893833 , 8995252 , 9020138 , (Europe PMC )NA BioGRID PTMA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PTPN1 Affinity Capture-Western, Co-fractionation, Reconstituted Complex, anti bait coimmunoprecipitation, coimmunoprecipitation, filter binding, phosphatase assay association, dephosphorylation reaction, direct interaction, physical, physical association 10889023 , 15866871 , 8940134 , 9407132 , 9418872 , (Europe PMC )0.79 BioGRID, IntAct, MINT PTPN11 Affinity Capture-Western physical 9188452 , (Europe PMC )NA BioGRID PTPN12 Affinity Capture-Western, Biochemical Activity, Proximity Label-MS, Reconstituted Complex, affinity chromatography technology, pull down direct interaction, physical, physical association 12714323 , 27880917 , 8887669 , 9285683 , 9748319 , (Europe PMC )0.60 BioGRID, IntAct, MINT PTPN14 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct PTPRH Reconstituted Complex physical 11278335 , (Europe PMC )NA BioGRID PXN Affinity Capture-Western physical 11577104 , 8810278 , (Europe PMC )NA BioGRID QKI anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RAI14 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RAN Two-hybrid physical 11032817 , (Europe PMC )NA BioGRID RAPGEF1 Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 9748234 , (Europe PMC )NA BioGRID RBM39 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RCN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RDX anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL10A anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL13A anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL18A anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL26 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL27 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL39 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL39P5 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL5 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPL7 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPLP2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPS11 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPS17 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct RPS6 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SAMD9L anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SARS anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SET anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SFN Affinity Capture-MS, tandem affinity purification physical, physical association 15778465 , (Europe PMC )0.40 BioGRID, IntAct, MINT SH2D3A Affinity Capture-Western physical 10187783 , (Europe PMC )NA BioGRID SH2D3C Affinity Capture-Western, anti bait coimmunoprecipitation, cosedimentation in solution, ion exchange chromatography, molecular sieving, pull down, x-ray crystallography direct interaction, physical, physical association 10692442 , 22081014 , (Europe PMC )0.69 BioGRID, IntAct SH3BGRL3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SH3KBP1 Affinity Capture-Western physical 11071869 , 12618476 , (Europe PMC )NA BioGRID SHROOM2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SIPA1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SLC25A11 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SLFN5 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SND1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SNX18 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SPIRE1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SPTAN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SPTBN1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SRC Affinity Capture-Western, Biochemical Activity, Reconstituted Complex, Two-hybrid, coimmunoprecipitation, fluorescence technology, pull down association, physical, physical association 10085298 , 10487518 , 10542110 , 10739664 , 11514617 , 12397603 , 12615911 , 15020686 , 16849545 , 17038317 , 17129785 , 21034468 , (Europe PMC )0.69 BioGRID, IntAct, MINT SRCIN1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti bait coimmunoprecipitation, confocal microscopy colocalization, physical, physical association 14657239 , (Europe PMC )0.46 BioGRID, IntAct SRGAP1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SRP54 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SRPK1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SRPK2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SRPK3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SSR3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SSR4 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct STIP1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SYNE2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct SYNJ1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TAOK2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TBCA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TFAM anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TFCP2 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TJP1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TKT anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TMOD1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TMOD3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TMSB10 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TMSB4X anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TNK2 Affinity Capture-Western, anti bait coimmunoprecipitation, pull down physical, physical association 17038317 , (Europe PMC )0.52 BioGRID, IntAct, MINT TNS1 Affinity Capture-Western physical 8810278 , (Europe PMC )NA BioGRID TNS3 anti bait coimmunoprecipitation, fluorescence microscopy, pull down colocalization, physical association 19732724 , (Europe PMC )0.56 IntAct TPM3 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TPP1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRIOBP anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TRIP4 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TRIP6 Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 11782456 , 14688263 , (Europe PMC )0.40 BioGRID, IntAct TSEN34 Co-fractionation physical 22863883 , (Europe PMC )NA BioGRID TSG101 Affinity Capture-Western, Co-localization physical 27764233 , (Europe PMC )NA BioGRID TUBA1C anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TUBA4A two hybrid pooling approach physical association 16169070 , (Europe PMC )0.37 IntAct TUBB8 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct TXNDC5 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct UACA anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct UBAP2L anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct UBP1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct UHRF2 Far Western, antibody array physical, physical association 21952639 , (Europe PMC )0.40 BioGRID, IntAct UPF1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct USP10 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct VCL Affinity Capture-Western, two hybrid array, two hybrid prey pooling approach physical, physical association 11577104 , (Europe PMC )0.49 BioGRID, IntAct VPS11 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct VPS39 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct YWHAE Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 17979178 , 28007913 , (Europe PMC )0.35 BioGRID, IntAct YWHAH tandem affinity purification association 17979178 , (Europe PMC )0.35 IntAct YWHAZ Affinity Capture-Western, Reconstituted Complex, Two-hybrid physical 10026197 , (Europe PMC )NA BioGRID ZC3H15 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct ZYX Affinity Capture-Western, anti bait coimmunoprecipitation physical, physical association 11782456 , (Europe PMC )0.40 BioGRID, IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
BMX Y12_NVLAKALyDNVAESP , NA NA PhosphoSitePlus , FGFR1 Y128_SKAQQGLyQVPGPSP , Y249_APGPQDIyDVPPVRG , Y306_PSNHHAVyDVPPSVS , Y327_PLLREETyDVPPAFA , Y410_GVVDSGVyAVPPPAE , LTP 12601080 ,(Europe PMC )PhosphoELM , PTK2 Y410_GVVDSGVyAVPPPAE , Y664_EGGWMEDyDYVHLQG , Y666_GWMEDYDyVHLQGKE , in vitro, in vivo 12119061 , 9360968 , 9360983 ,(Europe PMC )HPRD, PhosphoSitePlus , PTK6 Y165_PSPATDLyQVPPGPG , Y664_EGGWMEDyDYVHLQG , NA NA PhosphoSitePlus , SRC Y115_QPQPDSVyLVPTPSK , Y128_SKAQQGLyQVPGPSP , Y165_PSPATDLyQVPPGPG , Y179_GGPAQDIyQVPPSAG , Y192_AGMGHDIyQVPPSMD , Y234_AQPEQDEyDIPRHLL , Y267_SQYGQEVyDTPPMAV , Y287_RDPLLEVyDVPPSVE , Y362_SPPAEDVyDVPPPAP , Y387_RPGPGTLyDVPRERV , Y653_QDSPDGQyENSEGGW , LTP, in vitro, in vivo 11604500 , 12972425 , 17016520 , 17389395 , 19901323 ,(Europe PMC )HPRD, PhosphoELM , PhosphoSitePlus , Unknown S134_LYQVPGPsPQFQSPP , S139_GPSPQFQsPPAKQTS , S292_EVYDVPPsVEKGLPP , S428_PAEGKRLsASSTGST , S639_IQSRPLPsPPKFTSQ , T269_YGQEVYDtPPMAVKG , Y128_SKAQQGLyQVPGPSP , Y165_PSPATDLyQVPPGPG , Y222_PTRVGQGyVYEAAQP , Y224_RVGQGYVyEAAQPEQ , Y234_AQPEQDEyDIPRHLL , Y249_APGPQDIyDVPPVRG , Y306_PSNHHAVyDVPPSVS , Y326_GPLLREEyYDVPPAF , Y327_PLLREETyDVPPAFA , Y372_PPPAPDLyDVPPGLR , Y386_RRPGPGTyYDVPRER , Y387_RPGPGTLyDVPRERV , Y410_GVVDSGVyAVPPPAE , Y653_QDSPDGQyENSEGGW , Y664_EGGWMEDyDYVHLQG , HTP, LTP, in vitro, in vivo 11604500 , 12480533 , 12601080 , 15316024 , 15817476 , 16212419 , 16964243 , 17016520 , 17081983 , 17389395 , 18083107 , 18669648 , 19901323 , 20068231 , 8621540 , 8670206 ,(Europe PMC )HPRD, PhosphoELM ,