Top
ATF7
Localization (UniProt annotation) Nucleus Nucleus,nucleoplasm Note=Mainlynucleoplasmic Restricted distribution to the perinuculear regionThe sumoylated form locates to the nuclear periphery Isoform 5: Cytoplasm Function (UniProt annotation) Plays important functions in early cell signaling Bindsthe cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3'), a sequence present in many viral and cellular promotersActivator of the NF-ELAM1/delta-A site of the E-selectin promoterHas no intrinsic transcriptional activity, but activatestranscription on formation of JUN or FOS heterodimers Also canbind TRE promoter sequences when heterodimerized with members ofthe JUN family Isoform 4 acts as a dominant repressor of the E-selectin/NF-ELAM1/delta-A promoter Isoform 5 acts as a negative regulator, inhibiting bothATF2 and ATF7 transcriptional activities It may exert theseeffects by sequestrating in the cytoplasm the Thr-53phosphorylating kinase, preventing activation Catalytic Activity (UniProt annotation) N/A Protein Sequence MGDDRPFVCNAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARTDSVIIADQTPTPTRFLKNCEEVGLFNELASSFEHEFKK
AADEDEKKARSRTVAKKLVAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPDSPASSPCSPPLKEKEVTPKPVLISTPTPT
IVRPGSLPLHLGYDPLHPTLPSPTSVITQAPPSNRQMGSPTGSLPLVMHLANGQTMPVLPGPPVQMPSVISLARPVSMVP
NIPGIPGPPVNSSGSISPSGHPIPSEAKMRLKATLTHQVSSINGGCGMVVGTASTMVTARPEQSQILIQHPDAPSPAQPQ
VSPAQPTPSTGGRRRRTVDEDPDERRQRFLERNRAAASRCRQKRKLWVSSLEKKAEELTSQNIQLSNEVTLLRNEVAQLK
QLLLAHKDCPVTALQKKTQGYLESPKESSEPTGSPAPVIQHSSATAPSNGLSVRSAAEAVATSVLTQMASQRTELSMPIQ
SHVIMTPQSQSAGR
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ARIH1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ATF2 Affinity Capture-MS, peptide array direct interaction, physical 20102225 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct BACH1 Affinity Capture-MS, peptide array direct interaction, physical 20102225 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct BATF3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BCL6 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 16147992 , (Europe PMC )0.35 BioGRID, IntAct CCDC155 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct CREB1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID CREB5 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FAM9B Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct FCER2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct FOS Affinity Capture-MS, peptide array, tandem affinity purification association, direct interaction, physical 20102225 , 25609649 , 26186194 , 28514442 , (Europe PMC )0.59 BioGRID, IntAct, MINT FOSL2 Affinity Capture-MS, anti tag coimmunoprecipitation, peptide array association, direct interaction, physical 20102225 , 26186194 , 26496610 , 28514442 , (Europe PMC )0.35, 0.44 BioGRID, IntAct HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID JDP2 Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 18671972 , (Europe PMC )0.35 BioGRID, IntAct, MINT JUN Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, peptide array, tandem affinity purification association, direct interaction, physical 20102225 , 25609649 , 26496610 , (Europe PMC )0.35, 0.64 BioGRID, IntAct, MINT JUNB Affinity Capture-MS, peptide array direct interaction, physical 20102225 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct MAPK8 Affinity Capture-Western physical 11566021 , (Europe PMC )NA BioGRID MBD3 Two-hybrid, two hybrid physical, physical association 21516116 , (Europe PMC )0.37 BioGRID, IntAct, MINT MEF2A Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MITD1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct MLLT6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NFATC1 Affinity Capture-MS physical 27637333 , (Europe PMC )NA BioGRID NFATC2 Affinity Capture-MS physical 27637333 , (Europe PMC )NA BioGRID OCIAD1 Reconstituted Complex physical 20195357 , (Europe PMC )NA BioGRID PCF11 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPP2R2D Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PSMC5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PTP4A1 Reconstituted Complex, Two-hybrid physical 11278933 , (Europe PMC )NA BioGRID SCGN Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TAF12 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 15735663 , (Europe PMC )NA BioGRID TAF4 Affinity Capture-Western, Reconstituted Complex physical 15735663 , (Europe PMC )NA BioGRID TAOK3 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct TMEM239 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct URI1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct YY1 Reconstituted Complex physical 7769693 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACHE display technology physical association 20195357 , (Europe PMC )0.40 IntAct ATF2 Affinity Capture-MS, peptide array direct interaction, physical 20102225 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct ATF3 peptide array direct interaction 20102225 , (Europe PMC )0.44 IntAct ATF7 peptide array direct interaction 20102225 , (Europe PMC )0.44 IntAct BACH1 Affinity Capture-MS, peptide array direct interaction, physical 20102225 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct BCL6 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 16147992 , (Europe PMC )0.35 BioGRID, IntAct CCDC155 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct CEBPG peptide array direct interaction 20102225 , (Europe PMC )0.44 IntAct DDIT3 peptide array direct interaction 20102225 , (Europe PMC )0.44 IntAct FAM9B Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct FCER2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct FOS Affinity Capture-MS, peptide array, tandem affinity purification association, direct interaction, physical 20102225 , 25609649 , 26186194 , 28514442 , (Europe PMC )0.59 BioGRID, IntAct, MINT FOSL2 Affinity Capture-MS, anti tag coimmunoprecipitation, peptide array association, direct interaction, physical 20102225 , 26186194 , 26496610 , 28514442 , (Europe PMC )0.35, 0.44 BioGRID, IntAct JDP2 Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 18671972 , (Europe PMC )0.35 BioGRID, IntAct, MINT JUN Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, peptide array, tandem affinity purification association, direct interaction, physical 20102225 , 25609649 , 26496610 , (Europe PMC )0.35, 0.64 BioGRID, IntAct, MINT JUNB Affinity Capture-MS, peptide array direct interaction, physical 20102225 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct JUND peptide array direct interaction 20102225 , (Europe PMC )0.44 IntAct MBD3 Two-hybrid, two hybrid physical, physical association 21516116 , (Europe PMC )0.37 BioGRID, IntAct, MINT MEF2A Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MITD1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct NFE2 peptide array direct interaction 20102225 , (Europe PMC )0.44 IntAct NFE2L1 peptide array direct interaction 20102225 , (Europe PMC )0.44 IntAct OCIAD1 display technology, tandem affinity purification physical association 20195357 , (Europe PMC )0.52 IntAct RASA1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct TAOK3 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct TMEM239 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct URI1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source FOS Affinity Capture-MS, peptide array, tandem affinity purification association, direct interaction, physical 20102225 , 25609649 , 26186194 , 28514442 , (Europe PMC )0.59 BioGRID, IntAct, MINT JDP2 Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 18671972 , (Europe PMC )0.35 BioGRID, IntAct, MINT JUN Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, peptide array, tandem affinity purification association, direct interaction, physical 20102225 , 25609649 , 26496610 , (Europe PMC )0.35, 0.64 BioGRID, IntAct, MINT MBD3 Two-hybrid, two hybrid physical, physical association 21516116 , (Europe PMC )0.37 BioGRID, IntAct, MINT MEF2A Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACHE display technology physical association 20195357 , (Europe PMC )0.40 IntAct ARIH1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ATF2 Affinity Capture-MS, peptide array direct interaction, physical 20102225 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct ATF3 peptide array direct interaction 20102225 , (Europe PMC )0.44 IntAct ATF7 peptide array direct interaction 20102225 , (Europe PMC )0.44 IntAct BACH1 Affinity Capture-MS, peptide array direct interaction, physical 20102225 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct BATF3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BCL6 Affinity Capture-MS, anti bait coimmunoprecipitation association, physical 16147992 , (Europe PMC )0.35 BioGRID, IntAct CCDC155 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct CEBPG peptide array direct interaction 20102225 , (Europe PMC )0.44 IntAct CREB1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID CREB5 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DDIT3 peptide array direct interaction 20102225 , (Europe PMC )0.44 IntAct FAM9B Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct FCER2 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct FOS Affinity Capture-MS, peptide array, tandem affinity purification association, direct interaction, physical 20102225 , 25609649 , 26186194 , 28514442 , (Europe PMC )0.59 BioGRID, IntAct, MINT FOSL2 Affinity Capture-MS, anti tag coimmunoprecipitation, peptide array association, direct interaction, physical 20102225 , 26186194 , 26496610 , 28514442 , (Europe PMC )0.35, 0.44 BioGRID, IntAct HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID JDP2 Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 18671972 , (Europe PMC )0.35 BioGRID, IntAct, MINT JUN Affinity Capture-MS, anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, peptide array, tandem affinity purification association, direct interaction, physical 20102225 , 25609649 , 26496610 , (Europe PMC )0.35, 0.64 BioGRID, IntAct, MINT JUNB Affinity Capture-MS, peptide array direct interaction, physical 20102225 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct JUND peptide array direct interaction 20102225 , (Europe PMC )0.44 IntAct MAPK8 Affinity Capture-Western physical 11566021 , (Europe PMC )NA BioGRID MBD3 Two-hybrid, two hybrid physical, physical association 21516116 , (Europe PMC )0.37 BioGRID, IntAct, MINT MEF2A Affinity Capture-MS, tandem affinity purification association, physical 25609649 , (Europe PMC )0.35 BioGRID, IntAct, MINT MITD1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct MLLT6 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NFATC1 Affinity Capture-MS physical 27637333 , (Europe PMC )NA BioGRID NFATC2 Affinity Capture-MS physical 27637333 , (Europe PMC )NA BioGRID NFE2 peptide array direct interaction 20102225 , (Europe PMC )0.44 IntAct NFE2L1 peptide array direct interaction 20102225 , (Europe PMC )0.44 IntAct OCIAD1 Reconstituted Complex physical 20195357 , (Europe PMC )NA BioGRID OCIAD1 display technology, tandem affinity purification physical association 20195357 , (Europe PMC )0.52 IntAct PCF11 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID PPP2R2D Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PSMC5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PTP4A1 Reconstituted Complex, Two-hybrid physical 11278933 , (Europe PMC )NA BioGRID RASA1 display technology physical association 20195357 , (Europe PMC )0.40 IntAct SCGN Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TAF12 Affinity Capture-Western, Co-localization, Reconstituted Complex physical 15735663 , (Europe PMC )NA BioGRID TAF4 Affinity Capture-Western, Reconstituted Complex physical 15735663 , (Europe PMC )NA BioGRID TAOK3 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct TMEM239 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , (Europe PMC )0.56 BioGRID, IntAct URI1 Reconstituted Complex, display technology physical, physical association 20195357 , (Europe PMC )0.40 BioGRID, IntAct YY1 Reconstituted Complex physical 7769693 , (Europe PMC )NA BioGRID
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
MAPK11 T51_SVIIADQtPTPTRFL , NA NA PhosphoSitePlus , Unknown S100_TVAKKLVsAAGPLDM , S108_AAGPLDMsLPSTPDI , S171_PGSLPLHsGYDPLHP , S182_PLHPTLPsPTSVITQ , S413_HKDCPVTsLQKKTQG , S423_KKTQGYLsSPKESSE , S424_KTQGYLEsPKESSEP , S434_ESSEPTGsPAPVIQH , S437_EPTGSPAsVIQHSSA , S441_SPAPVIQsSSATAPS , S73_LFNELASsFEHEFKK , S97_RSRTVAKsLVAAAGP , T101_VAKKLVAtAGPLDMS , T112_LDMSLPStPDIKIKE , T137_PDSPASStCSPPLKE , T326_PQVSPAQtTPSTGGR , T407_KQLLLAHtDCPVTAL , T418_VTALQKKtQGYLESP , T51_SVIIADQtPTPTRFL , T53_IIADQTPtPTRFLKN , T55_ADQTPTPtRFLKNCE , HTP, in vivo 17081983 , 17322306 , 18452278 , 18669648 , 18767875 , 19413330 , 19651622 , 19664995 , 20068231 ,(Europe PMC )HPRD, PhosphoELM ,