Top
UBLCP1
Localization (UniProt annotation) Nucleus Note=Colocalizes with nuclearproteasomes Function (UniProt annotation) Dephosphorylates 26S nuclear proteasomes, therebydecreasing their proteolytic activity The dephosphorylation mayprevent assembly of the core and regulatory particles (CP and RP)into mature 26S proteasome Catalytic Activity (UniProt annotation) [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate Protein Sequence MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREE
SLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETGVE
LMRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFS
EFYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELLKLTQYLKEIAKLDDFLDLNHKYWERYLSKKQGQ
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Download FASTA sequences of UBLCP1-substrates in HumansSubstrate Gene Name Substrate UniProt_AC DephosphoSite and sequence (+/-5) Bioassay Type PubMed ID View in Europe PMC Reliability POLR2A P24928 Ser-1619,Ser-1647,Ser-1661,Ser-1675,Ser-1689,Ser-1703,Ser-1717,Ser-1731,Ser-1766,Ser-1794_SYSPTsPSYSP In vitro 15883030 , Europe PMC
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source BRAF Affinity Capture-MS physical 27034005 , (Europe PMC )NA BioGRID COLGALT1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID ERP29 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID FGB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FSD1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GTF2E2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID NUDT6 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PAAF1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PRPSAP1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PSMB2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMC1 Affinity Capture-MS, Reconstituted Complex physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMC2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMC3 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMC4 Affinity Capture-MS, Reconstituted Complex physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMC5 Affinity Capture-MS, Reconstituted Complex physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMC6 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD1 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD10 Affinity Capture-MS physical 28539385 , (Europe PMC )NA BioGRID PSMD11 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD12 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD13 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD14 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 23667555 , 25416956 , 27880917 , 28539385 , , (Europe PMC )0.76 BioGRID, IntAct PSMD3 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMD6 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD7 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD8 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID SEM1 Affinity Capture-MS physical 24811749 , (Europe PMC )NA BioGRID TARS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TSC22D4 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct UCHL5 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID ZFAND5 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source PSMD2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 23667555 , 25416956 , 27880917 , 28539385 , , (Europe PMC )0.76 BioGRID, IntAct SEM1 anti tag coimmunoprecipitation association 24811749 , (Europe PMC )0.35 IntAct, MINT TSC22D4 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source BRAF Affinity Capture-MS physical 27034005 , (Europe PMC )NA BioGRID COLGALT1 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID ERP29 Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID FGB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID FSD1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GTF2E2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HNRNPL Affinity Capture-RNA physical 28611215 , (Europe PMC )NA BioGRID NUDT6 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PAAF1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PRPSAP1 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID PSMB2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMC1 Affinity Capture-MS, Reconstituted Complex physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMC2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMC3 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMC4 Affinity Capture-MS, Reconstituted Complex physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMC5 Affinity Capture-MS, Reconstituted Complex physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMC6 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD1 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD10 Affinity Capture-MS physical 28539385 , (Europe PMC )NA BioGRID PSMD11 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD12 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD13 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD14 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD2 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 23667555 , 25416956 , 27880917 , 28539385 , , (Europe PMC )0.76 BioGRID, IntAct PSMD3 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD4 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID PSMD6 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD7 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID PSMD8 Affinity Capture-MS physical 27880917 , 28539385 , (Europe PMC )NA BioGRID SEM1 Affinity Capture-MS physical 24811749 , (Europe PMC )NA BioGRID SEM1 anti tag coimmunoprecipitation association 24811749 , (Europe PMC )0.35 IntAct, MINT TARS Co-fractionation physical 26344197 , (Europe PMC )NA BioGRID TSC22D4 Two-hybrid, two hybrid pooling approach physical, physical association 16189514 , (Europe PMC )0.37 BioGRID, IntAct UCHL5 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID ZFAND5 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID