Top
TIMM50
Localization (UniProt annotation) Mitochondrion inner membrane Isoform 2: Nucleus speckle Note=Nuclear and enriched inspeckles with snRNPs Function (UniProt annotation) Essential component of the TIM23 complex, a complex thatmediates the translocation of transit peptide-containing proteinsacross the mitochondrial inner membrane Has some phosphataseactivity in vitro; however such activity may not be relevant invivo Isoform 2: May participate in the release of snRNPs andSMN from the Cajal body Catalytic Activity (UniProt annotation) NA Protein Sequence MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTV
SVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLH
PEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRD
PARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQ
EEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (Reactome) R-HSA-1268020 Mitochondrial protein import. A human mitochondrion contains about 1500 proteins, more than 99% of which are encoded in the nucleus, synthesized in the cytosol and imported into the mitochondrion. Proteins are targeted to four locations (outer membrane, intermembrane space, inner membrane, and matrix) and must be sorted accordingly (reviewed in Kutik et al. 2007, Milenkovic et al. 2007, Bolender et al. 2008, Endo and Yamano 2009, Wiedemann and Pfanner 2017, Kang et al. 2018). Newly synthesized proteins are transported from the cytosol across the outer membrane by the TOMM40:TOMM70 complex. Proteins that contain presequences first interact with the TOMM20 subunit of the complex while proteins that contain internal targeting elements first interact with the TOMM70 subunit. After initial interaction the protein is conducted across the outer membrane by TOMM40 subunits. In yeast some proteins such as Aco1, Atp1, Cit1, Idh1, and Atp2 have both presequences that interact with TOM20 and mature regions that interact with TOM70 (Yamamoto et al. 2009).After passage across the outer membrane, proteins may be targeted to the outer membrane via the SAMM50 complex, to the inner membrane via the TIMM22 or TIMM23 complexes (reviewed in van der Laan et al. 2010), to the matrix via the TIMM23 complex (reviewed in van der Laan et al. 2010), or proteins may fold and remain in the intermembrane space (reviewed in Stojanovski et al. 2008, Deponte and Hell 2009, Sideris and Tokatlidis 2010). Presequences on matrix and inner membrane proteins cause interaction with TIMM23 complexes; internal targeting sequences cause outer membrane proteins to interact with the SAMM50 complex and inner membrane proteins to interact with the TIMM22 complex. While in the intermembrane space hydrophobic proteins are chaperoned by the TIMM8:TIMM13 complex and/or the TIMM9:TIMM10:FXC1 complex
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABI1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ABI2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ACAD9 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID ADRB2 Affinity Capture-MS physical 23798571 , (Europe PMC )NA BioGRID AKTIP Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct AMFR Affinity Capture-MS physical 21343306 , (Europe PMC )NA BioGRID ARAF Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 12620389 , 25852190 , (Europe PMC )0.55 BioGRID, IntAct BMI1 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID BPIFB1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BRK1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID C15orf48 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID CBX5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 20562864 , (Europe PMC )0.35 BioGRID, IntAct CCDC8 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CD55 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID CFTR Affinity Capture-MS physical 26618866 , (Europe PMC )NA BioGRID CHCHD10 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID CHCHD2 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID CISD3 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID COQ8B Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID COQ9 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID CTDSP2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CUL1 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CYFIP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CYFIP2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DNAJA4 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct DPF3 Affinity Capture-MS physical 26582913 , (Europe PMC )NA BioGRID DPP9 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID EGFR Affinity Capture-MS physical 23956138 , 24797263 , (Europe PMC )NA BioGRID ERLIN2 Affinity Capture-MS, tandem affinity purification association, physical 21343306 , (Europe PMC )0.35 BioGRID, IntAct ESRRB Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID FBXO6 Affinity Capture-MS physical 22268729 , (Europe PMC )NA BioGRID FUS Affinity Capture-MS physical 25192599 , (Europe PMC )NA BioGRID GNE Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HDAC6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23752268 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct ILK Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 23455922 , 25852190 , (Europe PMC )0.53 BioGRID, IntAct IRAK1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct JCHAIN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID KDM1A Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID MAGED1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MCM2 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MTMR11 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID MUC5B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NCKAP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NDUFA4 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID NDUFAF8 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID NFATC2 Affinity Capture-MS physical 27637333 , (Europe PMC )NA BioGRID NME4 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID NOS2 Affinity Capture-MS physical 23438482 , (Europe PMC )NA BioGRID OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID OCIAD1 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID PAFAH1B2 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PAN2 Affinity Capture-MS physical 23398456 , (Europe PMC )NA BioGRID PELO Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct PHB2 Affinity Capture-MS physical 17353931 , (Europe PMC )NA BioGRID PTPMT1 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID RAF1 Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 12620389 , 25852190 , (Europe PMC )0.55 BioGRID, IntAct RNF2 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID RPS6KB2 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID RYK Affinity Capture-MS physical 21875946 , (Europe PMC )NA BioGRID SDHA Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SDHB Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SFXN1 Co-fractionation, proximity-dependent biotin identification association, physical 22939629 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct SFXN3 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SHC1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID SLC25A6 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SMURF1 Affinity Capture-MS physical 23184937 , (Europe PMC )NA BioGRID SRSF5 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SUZ12 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID SYNCRIP Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TCF3 Affinity Capture-MS physical 22354994 , (Europe PMC )NA BioGRID TIMM13 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TIMM17B Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 23263864 , (Europe PMC )0.35 BioGRID, IntAct TNFRSF10B Two-hybrid physical 15044455 , (Europe PMC )NA BioGRID TOMM40 Co-fractionation physical 22939629 , 26344197 , (Europe PMC )NA BioGRID TOMM7 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TOMM70 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TP53 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRUB2 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID TUBA1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TUBA3E Affinity Capture-MS, tandem affinity purification physical, physical association 20360068 , (Europe PMC )0.40 BioGRID, IntAct TUBG1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct UBC Affinity Capture-MS physical 16196087 , (Europe PMC )NA BioGRID VAMP2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID WASF1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID WASF2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID WASF3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZKSCAN8 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF100 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF624 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF629 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF724 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF746 Affinity Capture-MS physical 25315684 , (Europe PMC )NA BioGRID ZNF852 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZSCAN20 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AIFM1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AKTIP Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct ARAF Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 12620389 , 25852190 , (Europe PMC )0.55 BioGRID, IntAct BRAF two hybrid physical association 12620389 , (Europe PMC )0.37 IntAct CBX5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 20562864 , (Europe PMC )0.35 BioGRID, IntAct CBX6 tandem affinity purification association 27705803 , (Europe PMC )0.35 IntAct CBX7 tandem affinity purification association 27705803 , (Europe PMC )0.35 IntAct COX14 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct COX15 blue native page association 23260140 , (Europe PMC )0.35 IntAct DNAJA4 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct DNM1 two hybrid pooling approach physical association 16169070 , (Europe PMC )0.37 IntAct ERBB2 tandem affinity purification association 24189400 , (Europe PMC )0.35 IntAct ERLIN2 Affinity Capture-MS, tandem affinity purification association, physical 21343306 , (Europe PMC )0.35 BioGRID, IntAct GABARAP anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GABARAPL1 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct HDAC6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23752268 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct IKBKB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct IKBKG tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct ILK Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 23455922 , 25852190 , (Europe PMC )0.53 BioGRID, IntAct IRAK1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KSR1 anti tag coimmunoprecipitation association 27086506 , (Europe PMC )0.35 IntAct L3MBTL1 tandem affinity purification association 27705803 , (Europe PMC )0.35 IntAct MAGED1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MAP1LC3A anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct MAP1LC3B anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct MAP3K1 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MAP3K14 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MAP3K3 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NFKB2 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NFKBIA tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NFKBIB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NFKBIE tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct PAFAH1B2 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PELO Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct PHB2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PPEF1 pull down association 28330616 , (Europe PMC )0.35 IntAct PPP1R15A anti tag coimmunoprecipitation association 29109149 , (Europe PMC )0.35 IntAct RAF1 Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 12620389 , 25852190 , (Europe PMC )0.55 BioGRID, IntAct RELA tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct RELB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct RIPK1 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct RIPK3 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct RIPK4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct SFXN1 Co-fractionation, proximity-dependent biotin identification association, physical 22939629 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct SLA anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TAB2 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TFAP2A two hybrid physical association 24835590 , (Europe PMC )0.37 IntAct TIMM17B Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 23263864 , (Europe PMC )0.35 BioGRID, IntAct TIMM21 anti tag coimmunoprecipitation association 23260140 , (Europe PMC )0.35 IntAct TIMM23 anti tag coimmunoprecipitation physical association 23260140 , (Europe PMC )0.40 IntAct TNFRSF1A tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TNFRSF1B tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TRAF1 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TSC22D1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TUBA1A pull down association 27291054 , (Europe PMC )0.35 IntAct TUBA1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TUBA3E Affinity Capture-MS, tandem affinity purification physical, physical association 20360068 , (Europe PMC )0.40 BioGRID, IntAct TUBB3 pull down association 27291054 , (Europe PMC )0.35 IntAct TUBG1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct YWHAZ anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ABI1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ABI2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ACAD9 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID ADRB2 Affinity Capture-MS physical 23798571 , (Europe PMC )NA BioGRID AIFM1 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct AKTIP Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct AMFR Affinity Capture-MS physical 21343306 , (Europe PMC )NA BioGRID ARAF Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 12620389 , 25852190 , (Europe PMC )0.55 BioGRID, IntAct BMI1 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID BPIFB1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BRAF two hybrid physical association 12620389 , (Europe PMC )0.37 IntAct BRK1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID C15orf48 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID CBX5 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 20562864 , (Europe PMC )0.35 BioGRID, IntAct CBX6 tandem affinity purification association 27705803 , (Europe PMC )0.35 IntAct CBX7 tandem affinity purification association 27705803 , (Europe PMC )0.35 IntAct CCDC8 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CD55 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID CFTR Affinity Capture-MS physical 26618866 , (Europe PMC )NA BioGRID CHCHD10 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID CHCHD2 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID CISD3 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID COQ8B Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID COQ9 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID COX14 proximity-dependent biotin identification association 29568061 , (Europe PMC )0.35 IntAct COX15 blue native page association 23260140 , (Europe PMC )0.35 IntAct CTDSP2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CUL1 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL3 Affinity Capture-MS physical 21145461 , (Europe PMC )NA BioGRID CUL7 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID CYFIP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CYFIP2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DNAJA4 Affinity Capture-Luminescence, Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25036637 , (Europe PMC )0.35 BioGRID, IntAct DNM1 two hybrid pooling approach physical association 16169070 , (Europe PMC )0.37 IntAct DPF3 Affinity Capture-MS physical 26582913 , (Europe PMC )NA BioGRID DPP9 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID EGFR Affinity Capture-MS physical 23956138 , 24797263 , (Europe PMC )NA BioGRID ERBB2 tandem affinity purification association 24189400 , (Europe PMC )0.35 IntAct ERLIN2 Affinity Capture-MS, tandem affinity purification association, physical 21343306 , (Europe PMC )0.35 BioGRID, IntAct ESRRB Affinity Capture-MS physical 24189400 , (Europe PMC )NA BioGRID FBXO6 Affinity Capture-MS physical 22268729 , (Europe PMC )NA BioGRID FUS Affinity Capture-MS physical 25192599 , (Europe PMC )NA BioGRID GABARAP anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GABARAPL1 anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct GNE Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID HDAC6 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 23752268 , 28514442 , (Europe PMC )0.35 BioGRID, IntAct IKBKB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct IKBKG tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct ILK Affinity Capture-MS, anti tag coimmunoprecipitation, tandem affinity purification association, physical 23455922 , 25852190 , (Europe PMC )0.53 BioGRID, IntAct IRAK1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 25852190 , (Europe PMC )0.35 BioGRID, IntAct JCHAIN Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID JUN anti bait coimmunoprecipitation association 25609649 , (Europe PMC )0.35 IntAct, MINT KDM1A Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID KEAP1 Affinity Capture-MS physical 27621311 , (Europe PMC )NA BioGRID KSR1 anti tag coimmunoprecipitation association 27086506 , (Europe PMC )0.35 IntAct L3MBTL1 tandem affinity purification association 27705803 , (Europe PMC )0.35 IntAct MAGED1 Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct MAP1LC3A anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct MAP1LC3B anti tag coimmunoprecipitation association 20562859 , (Europe PMC )0.35 IntAct MAP3K1 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MAP3K14 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MAP3K3 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct MCM2 Affinity Capture-MS physical 25963833 , (Europe PMC )NA BioGRID MTMR11 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID MUC5B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NCKAP1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NDUFA4 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID NDUFAF8 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID NFATC2 Affinity Capture-MS physical 27637333 , (Europe PMC )NA BioGRID NFKB2 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NFKBIA tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NFKBIB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NFKBIE tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct NME4 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID NOS2 Affinity Capture-MS physical 23438482 , (Europe PMC )NA BioGRID OBSL1 Affinity Capture-MS physical 24711643 , (Europe PMC )NA BioGRID OCIAD1 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID PAFAH1B2 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PAN2 Affinity Capture-MS physical 23398456 , (Europe PMC )NA BioGRID PELO Affinity Capture-MS, anti bait coimmunoprecipitation physical, physical association 17353931 , (Europe PMC )0.40 BioGRID, IntAct PHB2 Affinity Capture-MS physical 17353931 , (Europe PMC )NA BioGRID PHB2 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PLEKHA7 anti bait coimmunoprecipitation association 28877994 , (Europe PMC )0.35 IntAct PPEF1 pull down association 28330616 , (Europe PMC )0.35 IntAct PPP1R15A anti tag coimmunoprecipitation association 29109149 , (Europe PMC )0.35 IntAct PTPMT1 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID RAF1 Affinity Capture-MS, anti tag coimmunoprecipitation, two hybrid association, physical, physical association 12620389 , 25852190 , (Europe PMC )0.55 BioGRID, IntAct RELA tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct RELB tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct RIPK1 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct RIPK3 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct RIPK4 anti tag coimmunoprecipitation association 26972000 , (Europe PMC )0.35 IntAct RNF2 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID RPS6KB2 Affinity Capture-MS physical 25324306 , (Europe PMC )NA BioGRID RYK Affinity Capture-MS physical 21875946 , (Europe PMC )NA BioGRID SDHA Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SDHB Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SFXN1 Co-fractionation, proximity-dependent biotin identification association, physical 22939629 , 29568061 , (Europe PMC )0.35 BioGRID, IntAct SFXN3 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SHC1 Affinity Capture-MS physical 19380743 , (Europe PMC )NA BioGRID SLA anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SLC25A6 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SMURF1 Affinity Capture-MS physical 23184937 , (Europe PMC )NA BioGRID SRSF5 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID SUZ12 Affinity Capture-MS physical 24457600 , (Europe PMC )NA BioGRID SYNCRIP Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TAB2 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TCF3 Affinity Capture-MS physical 22354994 , (Europe PMC )NA BioGRID TFAP2A two hybrid physical association 24835590 , (Europe PMC )0.37 IntAct TIMM13 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TIMM17B Affinity Capture-Western, anti bait coimmunoprecipitation association, physical 23263864 , (Europe PMC )0.35 BioGRID, IntAct TIMM21 anti tag coimmunoprecipitation association 23260140 , (Europe PMC )0.35 IntAct TIMM23 anti tag coimmunoprecipitation physical association 23260140 , (Europe PMC )0.40 IntAct TNFRSF10B Two-hybrid physical 15044455 , (Europe PMC )NA BioGRID TNFRSF1A tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TNFRSF1B tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TOMM40 Co-fractionation physical 22939629 , 26344197 , (Europe PMC )NA BioGRID TOMM7 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TOMM70 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID TP53 Affinity Capture-MS physical 23443559 , (Europe PMC )NA BioGRID TRAF1 tandem affinity purification physical association 14743216 , (Europe PMC )0.40 IntAct TRIM25 Affinity Capture-RNA physical 29117863 , (Europe PMC )NA BioGRID TRUB2 Affinity Capture-MS physical 27499296 , (Europe PMC )NA BioGRID TSC22D1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct TUBA1A pull down association 27291054 , (Europe PMC )0.35 IntAct TUBA1C Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct TUBA3E Affinity Capture-MS, tandem affinity purification physical, physical association 20360068 , (Europe PMC )0.40 BioGRID, IntAct TUBB3 pull down association 27291054 , (Europe PMC )0.35 IntAct TUBG1 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct UBC Affinity Capture-MS physical 16196087 , (Europe PMC )NA BioGRID VAMP2 Co-fractionation physical 22939629 , (Europe PMC )NA BioGRID WASF1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID WASF2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID WASF3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID YWHAZ anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct ZKSCAN8 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF100 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF624 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF629 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF724 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZNF746 Affinity Capture-MS physical 25315684 , (Europe PMC )NA BioGRID ZNF852 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ZSCAN20 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID