Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
Top
STYXL1
Gene Name  | STYXL1 (QuickGO) | (A quick tutorial to explore the interactive visualization) |
| Synonyms | STYXL1, DUSP24, MKSTYX | |
| Protein Name | STYXL1 |
|
|
Alternative Name(s) |
Serine/threonine/tyrosine-interacting-like protein 1;Dual specificity phosphatase inhibitor MK-STYX;Dual specificity protein phosphatase 24;Inactive dual specificity protein phosphatase MK-STYX;Map kinase phosphatase-like protein MK-STYX; | |
| EntrezGene ID | 51657 (Comparative Toxicogenomics) | |
| UniProt AC (Human) | Q9Y6J8 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 35818 Dalton | |
| Protein Length | 313 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000127952 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class I Cys-based PTPs --> Family: DSP | Historic class: Class I Cys-based PTPs --> VH1-like or DSPs --> Atypical DSPs | CATH ID: 3.90.190.10 | SCOP Fold: CC1 | |
| Phosphatase activity | inactive | Catalytic signature motif: FSTQGISR | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | COSMIC | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Mitochondrion matrix | |||
| Function (UniProt annotation) | |||
| Catalytically inactive phosphatase (PubMed:20180778,PubMed:23163895) By binding to G3BP1, inhibits the formation ofG3BP1-induced stress granules (PubMed:20180778, PubMed:23163895)Does not act by protecting the dephosphorylation of G3BP1 at 'Ser-149' (PubMed:23163895) Inhibits PTPMT1 phosphatase activity(PubMed:24709986) By inhibiting PTPMT1, positively regulatesintrinsic apoptosis (PubMed:21262771) May play a role in theformation of neurites during neuronal development(PubMed:29250526) | |||
| Catalytic Activity (UniProt annotation) | |||
| NA | |||
| Protein Sequence | |||
| MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNN SSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYP IEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGS VILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMCPNRGLVSQLLEWEKTILGDSITNIMDPLY |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0001691 | F:pseudophosphatase activity |
| GO:0004864 | F:protein phosphatase inhibitor activity |
| GO:0005739 | C:mitochondrion |
| GO:0005759 | C:mitochondrial matrix |
| GO:0008138 | F:protein tyrosine/serine/threonine phosphatase activity |
| GO:0010976 | P:positive regulation of neuron projection development |
| GO:0019903 | F:protein phosphatase binding |
| GO:0032515 | P:negative regulation of phosphoprotein phosphatase activity |
| GO:0035556 | P:intracellular signal transduction |
| GO:0062030 | P:negative regulation of stress granule assembly |
| GO:2001242 | P:regulation of intrinsic apoptotic signaling pathway |
| GO:2001244 | P:positive regulation of intrinsic apoptotic signaling pathway |