Top
PTPRK
Localization (UniProt annotation) Cell junction, adherens junction Cellmembrane; Single-pass type I membrane protein Function (UniProt annotation) Regulation of processes involving cell contact andadhesion such as growth control, tumor invasion, and metastasisNegative regulator of EGFR signaling pathway Forms complexes withbeta-catenin and gamma-catenin/plakoglobin Beta-catenin may be asubstrate for the catalytic activity of PTPRK/PTP-kappa Catalytic Activity (UniProt annotation) Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate Protein Sequence MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSAGGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPPEMPQGSYMIV
DSSDHDPGEKARLQLPTMKENDTHCIDFSYLLYSQKGLNPGTLNILVRVNKGPLANPIWNVTGFTGRDWLRAELAVSTFW
PNEYQVIFEAEVSGGRSGYIAIDDIQVLSYPCDKSPHFLRLGDVEVNAGQNATFQCIATGRDAVHNKLWLQRRNGEDIPV
AQTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERGSGVSNFAQLIVREPPRPIAPPQLLGVGPTYLLIQLNANSIIGD
GPIILKEVEYRMTSGSWTETHAVNAPTYKLWHLDPDTEYEIRVLLTRPGEGGTGLPGPPLITRTKCAEPMRTPKTLKIAE
IQARRIAVDWESLGYNITRCHTFNVTICYHYFRGHNESKADCLDMDPKAPQHVVNHLPPYTNVSLKMILTNPEGRKESEE
TIIQTDEDVPGPVPVKSLQGTSFENKIFLNWKEPLDPNGIITQYEISYSSIRSFDPAVPVAGPPQTVSNLWNSTHHVFMH
LHPGTTYQFFIRASTVKGFGPATAINVTTNISAPTLPDYEGVDASLNETATTITVLLRPAQAKGAPISAYQIVVEELHPH
RTKREAGAMECYQVPVTYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPPLAPRKGYNIYFQAMSSVEKE
TKTQCVRIATKAATEEPEVIPDPAKQTDRVVKIAGISAGILVFILLLLVVILIVKKSKLAKKRKDAMGNTRQEMTHMVNA
MDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAESSRLLDVPRYLCEGTESPYQTGQLHPAIRVADLLQHINLMK
TSDSYGFKEEYESFFEGQSASWDVAKKDQNRAKNRYGNIIAYDHSRVILQPVEDDPSSDYINANYIDGYQRPSHYIATQG
PVHETVYDFWRMIWQEQSACIVMVTNLVEVGRVKCYKYWPDDTEVYGDFKVTCVEMEPLAEYVVRTFTLERRGYNEIREV
KQFHFTGWPDHGVPYHATGLLSFIRRVKLSNPPSAGPIVVHCSAGAGRTGCYIVIDIMLDMAEREGVVDIYNCVKALRSR
RINMVQTEEQYIFIHDAILEACLCGETAIPVCEFKAAYFDMIRIDSQTNSSHLKDEFQTLNSVTPRLQAEDCSIACLPRN
HDKNRFMDMLPPDRCLPFLITIDGESSNYINAALMDSYRQPAAFIVTQYPLPNTVKDFWRLVYDYGCTSIVMLNEVDLSQ
GCPQYWPEEGMLRYGPIQVECMSCSMDCDVINRIFRICNLTRPQEGYLMVQQFQYLGWASHREVPGSKRSFLKLILQVEK
WQEECEEGEGRTIIHCLNGGGRSGMFCAIGIVVEMVKRQNVVDVFHAVKTLRNSKPNMVEAPEQYRFCYDVALEYLESS
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Download FASTA sequences of PTPRK-substrates in Humans
Pathway ID Pathway Name Pathway Description (Reactome) R-HSA-182971 EGFR downregulation. Regulation of receptor tyrosine kinase (RTK) activity is implicated in the control of almost all cellular functions. One of the best understood RTKs is epidermal growth factor receptor (EGFR). Growth factors can bind to EGFR and activate it to initiate signalling cascades within the cell. EGFRs can also be recruited to clathrin-coated pits which can be internalised into endocytic vesicles. From here, EGFRs can either be recycled back to the plasma membrane or directed to lysosomes for destruction.This provides a mechanism by which EGFR signalling is negatively regulated and controls the strength and duration of EGFR-induced signals. It also prevents EGFR hyperactivation as commonly seen in tumorigenesis.The proto-oncogene Cbl can negatively regulate EGFR signalling. The Cbl family of RING-type ubiquitin ligases are able to poly-ubiquitinate EGFR, an essential step in EGFR degradation. All Cbl proteins have a unique domain that recognises phosphorylated tyrosine residues on activated EGFRs. They also direct the ubiquitination and degradation of activated EGFRs by recruiting ubiquitin-conjugation enzymes. Cbl proteins function by specifically targeting activated EGFRs and mediating their down-regulation, thus providing a means by which signaling processes can be negatively regulated.Cbl also promotes receptor internalization via it's interaction with an adaptor protein, CIN85 (Cbl-interacting protein of 85kDa). CIN85 binds to Cbl via it's SH3 domain and is enhanced by the EGFR-induced tyrosine phosphorylation of Cbl. The proline-rich region of CIN85 interacts with endophilins which are regulatory components of clathrin-coated vesicles (CCVs). Endophilins bind to membranes and induce membrane curvature, in conjunction with other proteins involved in CCV formation. The rapid recruitment of endophilin to the activated receptor complex by CIN85 is the mechanism which controls receptor internalization
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AMIGO1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID AMIGO3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ANKRD46 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARHGAP32 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID ARSA Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARSB Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARSG Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARSK Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ATP2A2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID ATRN Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID B3GLCT Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID BCHE Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID BMP7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BTD Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CACNA2D1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CACNA2D2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CCDC102A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CD109 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CERCAM Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CES3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CHST10 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CHST12 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CLN5 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CNTNAP3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID COL4A2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID COL6A1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID COL6A2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CSNK2B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CTNNB1 Affinity Capture-Western, Reconstituted Complex physical 8663237 , (Europe PMC )NA BioGRID CTSF Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DCBLD2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DEFA5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DGCR2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID DNAJB9 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ECE1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID EGFR Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID EOGT Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ERO1B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FBLN1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FKBP8 Affinity Capture-MS physical 17573772 , (Europe PMC )NA BioGRID FRAS1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID FUT11 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GADD45A Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GADD45G Two-hybrid, two hybrid physical, physical association 15383276 , (Europe PMC )0.37 BioGRID, IntAct GALNS Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GALNT18 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GLG1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID GNPTG Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HYAL2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID INSR Affinity Capture-MS, phosphatase assay dephosphorylation reaction, physical 19167335 , 26186194 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct ITGA4 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ITGA8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID JUP Affinity Capture-Western, Reconstituted Complex physical 8663237 , (Europe PMC )NA BioGRID LAMA3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LAMA5 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LAMB1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LAMB2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LGALS3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LGALS8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LGALS9 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LRIG1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LRIG3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID LRP1B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LYPD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAN2A1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID MAN2A2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MANBA Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MEGF8 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID MGRN1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID MICA Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MINK1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID MMP26 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MOXD1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID NCKAP5L Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID NID2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NPC1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID P3H3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PCDHGB1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCDHGB4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCSK5 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PEAK1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PIK3R1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PKP4 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PLAT Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PLXNA1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PLXNA2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PLXNA3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PLXNB2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID POGLUT1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PSMD11 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PTPRU Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PXDN Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID RIPK3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID RPL28 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SCARB1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SCARB2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SEC24B Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID SIAE Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID SIPA1L3 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID SP3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID SUSD1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TANC1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID TCTN2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TK1 Two-hybrid, two hybrid, two hybrid pooling approach physical, physical association 16169070 , 21900206 , (Europe PMC )0.55 BioGRID, IntAct, MINT TMEM132A Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID TMEM67 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TMPRSS11B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TUFM Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID UBR3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID WNT5A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ZNF3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ADAM9 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID AMIGO1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID AMIGO3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ANKRD46 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARHGAP32 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID ARSA Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARSB Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARSG Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARSK Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ATP2A2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID ATRN Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID B3GLCT Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID BCHE Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID BMP7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BTD Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CACNA2D1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CACNA2D2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CCDC102A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CD109 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CERCAM Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CES3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CHST10 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CHST12 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CLN5 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CNTNAP3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID COL4A2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID COL6A1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID COL6A2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CSNK2B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CTNNB1 Affinity Capture-Western, Reconstituted Complex physical 8663237 , (Europe PMC )NA BioGRID CTSF Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DCBLD2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DEFA5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DGCR2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID DNAJB9 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ECE1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID EGFR Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID EOGT Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ERO1B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FBLN1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FKBP8 Affinity Capture-MS physical 17573772 , (Europe PMC )NA BioGRID FRAS1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID FUT11 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GADD45A Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GADD45G Two-hybrid, two hybrid physical, physical association 15383276 , (Europe PMC )0.37 BioGRID, IntAct GALNS Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GALNT18 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GLG1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID GNPTG Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HYAL2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID INSR Affinity Capture-MS, phosphatase assay dephosphorylation reaction, physical 19167335 , 26186194 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct ITGA4 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ITGA8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID JUP Affinity Capture-Western, Reconstituted Complex physical 8663237 , (Europe PMC )NA BioGRID LAMA3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LAMA5 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LAMB1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LAMB2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LGALS3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LGALS8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LGALS9 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LRIG1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LRIG3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID LRP1B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LYPD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAN2A1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID MAN2A2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MANBA Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MEGF8 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID MGRN1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID MICA Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MINK1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID MMP26 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MOXD1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID NCKAP5L Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID NID2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NPC1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID P3H3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PCDHGB1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCDHGB4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCSK5 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PEAK1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PIK3R1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PKP4 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PLAT Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PLXNA1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PLXNA2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PLXNA3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PLXNB2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID POGLUT1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PSMD11 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PTPRU Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PXDN Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID RIPK3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID RPL28 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SCARB1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SCARB2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SEC24B Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID SIAE Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID SIPA1L3 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID SP3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID SUSD1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TANC1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID TCTN2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TK1 Two-hybrid, two hybrid, two hybrid pooling approach physical, physical association 16169070 , 21900206 , (Europe PMC )0.55 BioGRID, IntAct, MINT TMEM132A Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID TMEM67 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TMPRSS11B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TUFM Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID UBR3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID WNT5A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ZNF3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CDH2 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct CSK phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct CSNK2B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EBI-1108795 anti bait coimmunoprecipitation association 14968112 , (Europe PMC )0.35 IntAct ERBB2 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct GADD45A Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GADD45G Two-hybrid, two hybrid physical, physical association 15383276 , (Europe PMC )0.37 BioGRID, IntAct GHR phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct INSR Affinity Capture-MS, phosphatase assay dephosphorylation reaction, physical 19167335 , 26186194 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct LCK phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct LOX anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid physical association 21690299 , (Europe PMC )0.58 IntAct MAPK3 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct MET phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct NSF phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PDGFRB phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PDPK1 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PSMD11 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PTPRK tox-r dimerization assay association 15978577 , (Europe PMC )0.31 IntAct, MINT PXN phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct TEC phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct TEK phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct TK1 Two-hybrid, two hybrid, two hybrid pooling approach physical, physical association 16169070 , 21900206 , (Europe PMC )0.55 BioGRID, IntAct, MINT CBL phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct CDH2 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct CSK phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct CSNK2B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT EBI-1108795 anti bait coimmunoprecipitation association 14968112 , (Europe PMC )0.35 IntAct ERBB2 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct GADD45A Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GADD45G Two-hybrid, two hybrid physical, physical association 15383276 , (Europe PMC )0.37 BioGRID, IntAct GHR phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct INSR Affinity Capture-MS, phosphatase assay dephosphorylation reaction, physical 19167335 , 26186194 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct LCK phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct LOX anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid physical association 21690299 , (Europe PMC )0.58 IntAct MAPK3 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct MET phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct NSF phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PDGFRB phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PDPK1 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PSMD11 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PTPRK tox-r dimerization assay association 15978577 , (Europe PMC )0.31 IntAct, MINT PXN phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct TEC phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct TEK phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct TK1 Two-hybrid, two hybrid, two hybrid pooling approach physical, physical association 16169070 , 21900206 , (Europe PMC )0.55 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source PTPRK tox-r dimerization assay association 15978577 , (Europe PMC )0.31 IntAct, MINT TK1 Two-hybrid, two hybrid, two hybrid pooling approach physical, physical association 16169070 , 21900206 , (Europe PMC )0.55 BioGRID, IntAct, MINT CSNK2B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PTPRK tox-r dimerization assay association 15978577 , (Europe PMC )0.31 IntAct, MINT TK1 Two-hybrid, two hybrid, two hybrid pooling approach physical, physical association 16169070 , 21900206 , (Europe PMC )0.55 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AMIGO1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID AMIGO3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ANKRD46 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARHGAP32 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID ARSA Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARSB Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARSG Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARSK Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ATP2A2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID ATRN Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID B3GLCT Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID BCHE Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID BMP7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BTD Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CACNA2D1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CACNA2D2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CBL phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct CCDC102A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CD109 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CDH2 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct CERCAM Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CES3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CHST10 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CHST12 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CLN5 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CNTNAP3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID COL4A2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID COL6A1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID COL6A2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CSK phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct CSNK2B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CTNNB1 Affinity Capture-Western, Reconstituted Complex physical 8663237 , (Europe PMC )NA BioGRID CTSF Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DCBLD2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DEFA5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DGCR2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID DNAJB9 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID EBI-1108795 anti bait coimmunoprecipitation association 14968112 , (Europe PMC )0.35 IntAct ECE1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID EGFR Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID EOGT Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ERBB2 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct ERO1B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FBLN1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FKBP8 Affinity Capture-MS physical 17573772 , (Europe PMC )NA BioGRID FRAS1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID FUT11 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GADD45A Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GADD45G Two-hybrid, two hybrid physical, physical association 15383276 , (Europe PMC )0.37 BioGRID, IntAct GALNS Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GALNT18 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GHR phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct GLG1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID GNPTG Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HYAL2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID INSR Affinity Capture-MS, phosphatase assay dephosphorylation reaction, physical 19167335 , 26186194 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct ITGA4 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ITGA8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID JUP Affinity Capture-Western, Reconstituted Complex physical 8663237 , (Europe PMC )NA BioGRID LAMA3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LAMA5 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LAMB1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LAMB2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LCK phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct LGALS3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LGALS8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LGALS9 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LOX anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid physical association 21690299 , (Europe PMC )0.58 IntAct LRIG1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LRIG3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID LRP1B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LYPD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAN2A1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID MAN2A2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MANBA Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MAPK3 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct MEGF8 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID MET phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct MGRN1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID MICA Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MINK1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID MMP26 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MOXD1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID NCKAP5L Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID NID2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NPC1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID NSF phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct P3H3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PCDHGB1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCDHGB4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCSK5 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PDGFRB phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PDPK1 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PEAK1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PIK3R1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PKP4 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PLAT Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PLXNA1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PLXNA2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PLXNA3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PLXNB2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID POGLUT1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PSMD11 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PTPRK tox-r dimerization assay association 15978577 , (Europe PMC )0.31 IntAct, MINT PTPRU Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PXDN Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PXN phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct RIPK3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID RPL28 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SCARB1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SCARB2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SEC24B Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID SIAE Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID SIPA1L3 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID SP3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID SUSD1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TANC1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID TCTN2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TEC phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct TEK phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct TK1 Two-hybrid, two hybrid, two hybrid pooling approach physical, physical association 16169070 , 21900206 , (Europe PMC )0.55 BioGRID, IntAct, MINT TMEM132A Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID TMEM67 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TMPRSS11B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TUFM Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID UBR3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID WNT5A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ZNF3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ADAM9 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID AMIGO1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID AMIGO3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ANKRD46 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARHGAP32 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID ARSA Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARSB Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARSG Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ARSK Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ATP2A2 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID ATRN Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID B3GLCT Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID BCHE Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID BMP7 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID BTD Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CACNA2D1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CACNA2D2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CBL phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct CCDC102A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CD109 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CDH2 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct CERCAM Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CES3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CHST10 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CHST12 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CLN5 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID CNTNAP3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID COL4A2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID COL6A1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID COL6A2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CSK phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct CSNK2B Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CTNNB1 Affinity Capture-Western, Reconstituted Complex physical 8663237 , (Europe PMC )NA BioGRID CTSF Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DCBLD2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DEFA5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID DGCR2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID DNAJB9 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID EBI-1108795 anti bait coimmunoprecipitation association 14968112 , (Europe PMC )0.35 IntAct ECE1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID EGFR Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID EOGT Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ERBB2 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct ERO1B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FBLN1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID FKBP8 Affinity Capture-MS physical 17573772 , (Europe PMC )NA BioGRID FRAS1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID FUT11 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GADD45A Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct GADD45G Two-hybrid, two hybrid physical, physical association 15383276 , (Europe PMC )0.37 BioGRID, IntAct GALNS Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GALNT18 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GHR phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct GLG1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID GNPTG Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HYAL2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID INSR Affinity Capture-MS, phosphatase assay dephosphorylation reaction, physical 19167335 , 26186194 , 28514442 , (Europe PMC )0.44 BioGRID, IntAct ITGA4 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ITGA8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID JUP Affinity Capture-Western, Reconstituted Complex physical 8663237 , (Europe PMC )NA BioGRID LAMA3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LAMA5 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LAMB1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LAMB2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LCK phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct LGALS3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LGALS8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LGALS9 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LOX anti bait coimmunoprecipitation, anti tag coimmunoprecipitation, two hybrid physical association 21690299 , (Europe PMC )0.58 IntAct LRIG1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LRIG3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID LRP1B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LYPD1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAN2A1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID MAN2A2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MANBA Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MAPK3 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct MEGF8 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID MET phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct MGRN1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID MICA Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID MINK1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID MMP26 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MOXD1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID NCKAP5L Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID NID2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID NPC1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID NSF phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct P3H3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PCDHGB1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCDHGB4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PCSK5 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PDGFRB phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PDPK1 phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct PEAK1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PIK3R1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PKP4 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID PLAT Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PLXNA1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PLXNA2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PLXNA3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PLXNB2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID POGLUT1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PSMD11 Two-hybrid, two hybrid pooling approach physical, physical association 16169070 , (Europe PMC )0.37 BioGRID, IntAct PTPRK tox-r dimerization assay association 15978577 , (Europe PMC )0.31 IntAct, MINT PTPRU Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PXDN Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PXN phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct RIPK3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID RPL28 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID SCARB1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SCARB2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID SEC24B Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID SIAE Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID SIPA1L3 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID SP3 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID SUSD1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TANC1 Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID TCTN2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TEC phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct TEK phosphatase assay dephosphorylation reaction 19167335 , (Europe PMC )0.44 IntAct TK1 Two-hybrid, two hybrid, two hybrid pooling approach physical, physical association 16169070 , 21900206 , (Europe PMC )0.55 BioGRID, IntAct, MINT TMEM132A Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID TMEM67 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID TMPRSS11B Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TUFM Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID UBR3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID WNT5A Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ZNF3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID