Top
PTPN14
Gene Name PTPN14 (QuickGO )Interactive visualization of PTPN14 structures
(A quick tutorial to explore the interactive visualization)
Synonyms
PTPN14, PEZ, PTPD2
Protein Name
PTPN14
Alternative Name(s)
Tyrosine-protein phosphatase non-receptor type 14;3.1.3.48;Protein-tyrosine phosphatase pez;
EntrezGene ID 5784    (Comparative Toxicogenomics)
UniProt AC (Human)
Q15678
(protein sequence )
Enzyme Class EC 3.1.3.48 (BRENDA ) Molecular Weight 135261 Dalton Protein Length 1187 amino acids (AA) Genome Browsers NCBI | ENSG00000152104 (Ensembl) | UCSC Crosslinking annotations Query our ID-mapping tableOrthologues Quest For Orthologues (QFO) | GeneTree Classification Superfamily: Class I Cys-based PTPs --> Family: NR-PTP | Historic class: Class I Cys-based PTPs --> Classical PTPs --> Non-receptor type PTPs (NR-PTPs) | CATH ID: 3.90.190.10 | SCOP Fold: CC1 Phosphatase activity active | Catalytic signature motif: HCSAGVGR Phosphorylation Network Visualize
Localization (UniProt annotation) Cytoplasm Cytoplasm, cytoskeleton Nucleus Note=Translocation into the nucleus isassociated with induction of cell proliferation Partiallycolocalized with actin filaments at the plasma membrane Function (UniProt annotation) Protein tyrosine phosphatase which may play a role inthe regulation of lymphangiogenesis, cell-cell adhesion, cell-matrix adhesion, cell migration, cell growth and also regulatesTGF-beta gene expression, thereby modulating epithelial-mesenchymal transition Mediates beta-catenin dephosphorylation atadhesion junctions Acts as a negative regulator of the oncogenicproperty of YAP, a downstream target of the hippo pathway, in acell density-dependent manner May function as a tumor suppressor Catalytic Activity (UniProt annotation) Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate Protein Sequence MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETHYFGLWFLSKSQQARWVELEK
PLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYLQVKKDVLEGRLRCTLDQVIRLAGLAVQADFGDYNQFDSQD
FLREYVLFPMDLALEEAVLEELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEIFPVKDNHGNCVHLGIFFMGIF
VRNRIGRQAVIYRWNDMGNITHNKSTILVELINKEETALFHTDDIENAKYISRLFATRHKFYKQNKICTEQSNSPPPIRR
QPTWSRSSLPRQQPYILPPVHVQCGEHYSETHTSQDSIFHGNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCS
QSFIQASPVSSNLSIPGSDIMRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGILHTDSQSQSLRNLNIINTHAYNQP
EDLVYSQPEMRERHPYTVPYGPQGVYSNKLVSPSDQRNPKNNVVPSKPGASAISHTVSTPELANMQLQGSHNYSTAHMLK
NYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTRKVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGTVNKR
HSLEVMNSMVRGMEAMTLKSLHLPMARRNTLREQGPPEEGSGSHEVPQLPQYHHKKTFSDATMLIHSSESEEEEEEAPES
VPQIPMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARVLRHGPAKAISMSRTDPPAVN
GASLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSIIEREMMIRNLEKQKMAGLEAQKRPLMLAALNGLSVARVSG
REENRVDATRVPMDERFRTLKKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNT
GYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSHRYWPKLGSKHSSATYGKFKV
TTKFRTDSVCYATTGLKVKHLLSGQERTVWHLQYTDWPDHGCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVH
CSAGVGRTGVLILSELMIYCLEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (Reactome) R-HSA-9008059 Interleukin-37 signaling. Interleukins (IL) are immunomodulatory proteins that elicit a wide array of responses in cells and tissues. Interleukin 37 (IL37), also known as IL 1F7, is a member of the IL 1 family (Sharma et al. 2008). Isoform b of IL37 (referred just as IL37) is synthesized as a precursor that requires processing (primarily by caspase 1) to attain full receptor agonist or antagonist function (Kumar et al. 2002). Both full length and processed IL37 can bind to the IL 18 binding protein (IL 18BP) and the Interleukin 18 receptor 1 (IL 18R1) (Shi et al. 2003). Upon binding to the IL18R1, IL37 recruits Single Ig IL 1 related receptor (SIGIRR) (Nold-Petry et al. 2015). The IL37:IL18R1 complex can activate phosphorylation of Signal transducer and activator of transcription 3 (STAT3), Tyrosine protein kinase Mer and Phosphatidylinositol 3,4,5 trisphosphate 3 phosphatase and dual specificity protein phosphatase PTEN and can also inhibit Nuclear factor NF kappa B p105 subunit (NFKB) (Nold-Petry et al. 2015). Processed IL37 can be secreted from the cytosol to the extracellular space or translocated into the nucleus (Bulau et al. 2014). Full length IL37 can also be secreted from the cytosol to the extracellular space (Bulau et al. 2014). Processed IL37 can bind with Mothers against decapentaplegic homolog 3 (SMAD3) in the cytosol and then translocate to the nucleus, where it facilitates transcription of Tyrosine protein phosphatase non receptors (PTPNs) (Nold et al. 2010, Luo et al. 2017). These events ultimately lead to suppression of cytokine production in several types of immune cells resulting in reduced inflammation
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACAD8 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID AMMECR1L Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID AMOT Affinity Capture-MS physical 22948661 , 27432908 , (Europe PMC )NA BioGRID ANKRD50 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID ARMC8 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID ATE1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID BAG3 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID BPIFB1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CBY1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct CCT8L1P Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct COPS4 Affinity Capture-MS physical 22948661 , 27432908 , (Europe PMC )NA BioGRID CRLF3 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CSNK1D Affinity Capture-MS physical 22948661 , (Europe PMC )NA BioGRID CTDSPL Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID CTNNA1 Affinity Capture-MS physical 12808048 , (Europe PMC )NA BioGRID CTNNB1 Affinity Capture-MS, Affinity Capture-Western physical 12808048 , (Europe PMC )NA BioGRID CUL2 Affinity Capture-MS, Affinity Capture-Western physical 22948661 , 27432908 , (Europe PMC )NA BioGRID DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DDB1 Affinity Capture-MS physical 22948661 , (Europe PMC )NA BioGRID DENND1A Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID DENND4C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct GPS1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID HDAC4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct HECW2 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID INPP5E Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct JPH4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID JUP Affinity Capture-MS physical 12808048 , (Europe PMC )NA BioGRID KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KIF2A Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LATS1 Affinity Capture-Western, Proximity Label-MS physical 24255178 , 25023289 , (Europe PMC )NA BioGRID LATS2 Proximity Label-MS physical 24255178 , (Europe PMC )NA BioGRID LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LRR1 Affinity Capture-MS, Affinity Capture-Western physical 22948661 , 27432908 , (Europe PMC )NA BioGRID MAEA Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , 28514442 , , (Europe PMC )0.27 BioGRID, IntAct MAGI3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MOB1A Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct MOB1B Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct MYC Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct NDEL1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID NF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct NPM1 Affinity Capture-MS physical 23402259 , (Europe PMC )NA BioGRID PARD6B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PDLIM7 Affinity Capture-MS physical 27432908 , 27880917 , 28514442 , (Europe PMC )NA BioGRID PHF20 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PLK1 Affinity Capture-MS physical 22948661 , 27432908 , (Europe PMC )NA BioGRID PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PPP2R1A Affinity Capture-MS physical 22948661 , (Europe PMC )NA BioGRID PPP2R2A Affinity Capture-MS physical 22948661 , (Europe PMC )NA BioGRID PTEN Affinity Capture-MS physical 15717329 , (Europe PMC )NA BioGRID PTPN14 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RANBP10 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RHPN1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RMND5A Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RTKN Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID SAV1 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SRSF12 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct STK3 Affinity Capture-MS physical 22948661 , 27432908 , (Europe PMC )NA BioGRID STXBP4 Affinity Capture-MS physical 27432908 , 28514442 , (Europe PMC )NA BioGRID SYDE1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct TJP1 Affinity Capture-MS physical 12808048 , (Europe PMC )NA BioGRID UBC Affinity Capture-MS physical 22948661 , (Europe PMC )NA BioGRID USP9X Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID VHL Affinity Capture-Western physical 22948661 , (Europe PMC )NA BioGRID WDR26 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID WWC1 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 22948661 , 24366813 , 25023289 , 27432908 , 28720576 , (Europe PMC )0.35 BioGRID, IntAct WWC2 Affinity Capture-MS physical 22948661 , 27432908 , (Europe PMC )NA BioGRID WWOX Affinity Capture-MS physical 24550385 , (Europe PMC )NA BioGRID WWP1 Affinity Capture-MS physical 22948661 , 27432908 , (Europe PMC )NA BioGRID WWP2 Affinity Capture-MS physical 22948661 , 25071155 , (Europe PMC )NA BioGRID YAP1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, isothermal titration calorimetry, tandem affinity purification association, direct interaction, physical 22948661 , 24255178 , 24366813 , 25283809 , 25751139 , 25796446 , 27432908 , 28514442 , (Europe PMC )0.76 BioGRID, IntAct, MINT YWHAB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22948661 , 24255178 , 27432908 , (Europe PMC )0.35 BioGRID, IntAct YWHAE Affinity Capture-MS physical 17979178 , 22948661 , (Europe PMC )NA BioGRID YWHAG Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID YWHAH Affinity Capture-MS, tandem affinity purification association, physical 17979178 , 27432908 , (Europe PMC )0.35 BioGRID, IntAct YWHAZ Affinity Capture-MS physical 22948661 , (Europe PMC )NA BioGRID ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CBY1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DENND4C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct HDAC4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct INPP5E Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LATS1 proximity-dependent biotin identification colocalization 24255178 , (Europe PMC )0.35 IntAct LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , 28514442 , , (Europe PMC )0.27 BioGRID, IntAct MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MOB1A Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct MOB1B Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct MYC Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct NF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SAV1 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SRSF12 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SYDE1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct WWC1 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 22948661 , 24366813 , 25023289 , 27432908 , 28720576 , (Europe PMC )0.35 BioGRID, IntAct YAP1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, isothermal titration calorimetry, tandem affinity purification association, direct interaction, physical 22948661 , 24255178 , 24366813 , 25283809 , 25751139 , 25796446 , 27432908 , 28514442 , (Europe PMC )0.76 BioGRID, IntAct, MINT YWHAB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22948661 , 24255178 , 27432908 , (Europe PMC )0.35 BioGRID, IntAct YWHAH Affinity Capture-MS, tandem affinity purification association, physical 17979178 , 27432908 , (Europe PMC )0.35 BioGRID, IntAct ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACAD8 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID AMMECR1L Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID AMOT Affinity Capture-MS physical 22948661 , 27432908 , (Europe PMC )NA BioGRID ANKRD50 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID ARMC8 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID ATE1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID BAG3 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID BCAR1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct BPIFB1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CBY1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct CCT8L1P Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct COPS4 Affinity Capture-MS physical 22948661 , 27432908 , (Europe PMC )NA BioGRID CRLF3 Affinity Capture-MS physical 27880917 , (Europe PMC )NA BioGRID CSNK1D Affinity Capture-MS physical 22948661 , (Europe PMC )NA BioGRID CTDSPL Proximity Label-MS physical 27880917 , (Europe PMC )NA BioGRID CTNNA1 Affinity Capture-MS physical 12808048 , (Europe PMC )NA BioGRID CTNNB1 Affinity Capture-MS, Affinity Capture-Western physical 12808048 , (Europe PMC )NA BioGRID CUL2 Affinity Capture-MS, Affinity Capture-Western physical 22948661 , 27432908 , (Europe PMC )NA BioGRID DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DDB1 Affinity Capture-MS physical 22948661 , (Europe PMC )NA BioGRID DENND1A Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID DENND4C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct GPS1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID HDAC4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct HECW2 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID INPP5E Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct JPH4 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID JUP Affinity Capture-MS physical 12808048 , (Europe PMC )NA BioGRID KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KIF2A Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LATS1 Affinity Capture-Western, Proximity Label-MS physical 24255178 , 25023289 , (Europe PMC )NA BioGRID LATS1 proximity-dependent biotin identification colocalization 24255178 , (Europe PMC )0.35 IntAct LATS2 Proximity Label-MS physical 24255178 , (Europe PMC )NA BioGRID LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LRR1 Affinity Capture-MS, Affinity Capture-Western physical 22948661 , 27432908 , (Europe PMC )NA BioGRID MAEA Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , 28514442 , , (Europe PMC )0.27 BioGRID, IntAct MAGI3 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MOB1A Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct MOB1B Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct MYC Affinity Capture-MS, tandem affinity purification association, physical 17314511 , 21150319 , (Europe PMC )0.53 BioGRID, IntAct NDEL1 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID NF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct NPM1 Affinity Capture-MS physical 23402259 , (Europe PMC )NA BioGRID PARD6B Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID PDLIM7 Affinity Capture-MS physical 27432908 , 27880917 , 28514442 , (Europe PMC )NA BioGRID PHF20 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PLK1 Affinity Capture-MS physical 22948661 , 27432908 , (Europe PMC )NA BioGRID PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PPP2R1A Affinity Capture-MS physical 22948661 , (Europe PMC )NA BioGRID PPP2R2A Affinity Capture-MS physical 22948661 , (Europe PMC )NA BioGRID PTEN Affinity Capture-MS physical 15717329 , (Europe PMC )NA BioGRID PTPN14 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RANBP10 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RHPN1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RMND5A Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID RTKN Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID SAV1 Proximity Label-MS, proximity-dependent biotin identification colocalization, physical 24255178 , (Europe PMC )0.35 BioGRID, IntAct SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SRSF12 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct STK3 Affinity Capture-MS physical 22948661 , 27432908 , (Europe PMC )NA BioGRID STXBP4 Affinity Capture-MS physical 27432908 , 28514442 , (Europe PMC )NA BioGRID SYDE1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct TJP1 Affinity Capture-MS physical 12808048 , (Europe PMC )NA BioGRID UBC Affinity Capture-MS physical 22948661 , (Europe PMC )NA BioGRID USP9X Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID VHL Affinity Capture-Western physical 22948661 , (Europe PMC )NA BioGRID WDR26 Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID WWC1 Affinity Capture-MS, Affinity Capture-Western, anti tag coimmunoprecipitation association, physical 22948661 , 24366813 , 25023289 , 27432908 , 28720576 , (Europe PMC )0.35 BioGRID, IntAct WWC2 Affinity Capture-MS physical 22948661 , 27432908 , (Europe PMC )NA BioGRID WWOX Affinity Capture-MS physical 24550385 , (Europe PMC )NA BioGRID WWP1 Affinity Capture-MS physical 22948661 , 27432908 , (Europe PMC )NA BioGRID WWP2 Affinity Capture-MS physical 22948661 , 25071155 , (Europe PMC )NA BioGRID YAP1 Affinity Capture-MS, Affinity Capture-Western, Reconstituted Complex, anti tag coimmunoprecipitation, isothermal titration calorimetry, tandem affinity purification association, direct interaction, physical 22948661 , 24255178 , 24366813 , 25283809 , 25751139 , 25796446 , 27432908 , 28514442 , (Europe PMC )0.76 BioGRID, IntAct, MINT YWHAB Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 22948661 , 24255178 , 27432908 , (Europe PMC )0.35 BioGRID, IntAct YWHAE Affinity Capture-MS physical 17979178 , 22948661 , (Europe PMC )NA BioGRID YWHAG Affinity Capture-MS physical 27432908 , (Europe PMC )NA BioGRID YWHAH Affinity Capture-MS, tandem affinity purification association, physical 17979178 , 27432908 , (Europe PMC )0.35 BioGRID, IntAct YWHAZ Affinity Capture-MS physical 22948661 , (Europe PMC )NA BioGRID ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct
Phosphorylating Kinases Phosphoresidues Detection Method PubMed IDs Source
Visualize a network of protein kinases and phosphatases phosphorylating and dephosphorylating this protein respectively
Unknown S314_ICTEQSNsPPPIRRQ , S486_QPEDLVYsQPEMRER , S512_VYSNKLVsPSDQRNP , S584_TSTPDLAsHRHKYVS , S593_RHKYVSGsSPDLVTR , S594_HKYVSGSsPDLVTRK , S809_ASLGPSIsEPDLTSV , HTP, in vivo 17081983 , 17525332 , 18077418 , 18691976 , 19413330 , 19415658 , 19664994 , 19664995 ,(Europe PMC )HPRD, PhosphoELM ,