Top
PMM1
Localization (UniProt annotation) Cytoplasm Function (UniProt annotation) Involved in the synthesis of the GDP-mannose anddolichol-phosphate-mannose required for a number of criticalmannosyl transfer reactions In addition, may be responsible forthe degradation of glucose-1,6-bisphosphate in ischemic brain Catalytic Activity (UniProt annotation) Alpha-D-mannose 1-phosphate = D-mannose 6-phosphate Protein Sequence MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAEN
GTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKE
KIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSV
VSPQDTVQRCREIFFPETAHEA
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (Reactome) R-HSA-446205 Synthesis of GDP-mannose. GDP-mannose is the mannose donor for the first 5 mannose addition reactions in the N-glycan precursor synthesis, and also for the synthesis of Dolichyl-phosphate-mannose involved in other mannose transfer reactions. It is synthesized from fructose 6-phosphate and GTP in three steps
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source DSG4 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DUSP14 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID GNB2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HEPHL1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LRRC15 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID PMM2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID POTEE Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID QRICH1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID RAB6A Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 25416956 , , (Europe PMC )0.49, 0.67 BioGRID, IntAct RCHY1 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct VSIG8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ZSCAN26 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source E2F3 pull down association 22157815 , (Europe PMC )0.35 IntAct, MINT MFHAS1 protein array direct interaction 29513927 , (Europe PMC )0.44 IntAct RAB6A Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 25416956 , , (Europe PMC )0.49, 0.67 BioGRID, IntAct RCHY1 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct ZSCAN26 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source DSG4 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID DUSP14 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID E2F3 pull down association 22157815 , (Europe PMC )0.35 IntAct, MINT GNB2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HEPHL1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID LRRC15 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID MFHAS1 protein array direct interaction 29513927 , (Europe PMC )0.44 IntAct PMM2 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID POTEE Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID QRICH1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID RAB6A Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach, validated two hybrid physical, physical association 16189514 , 25416956 , , (Europe PMC )0.49, 0.67 BioGRID, IntAct RCHY1 Two-hybrid, two hybrid physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct VSIG8 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ZSCAN26 Affinity Capture-MS, anti tag coimmunoprecipitation association, physical 26496610 , (Europe PMC )0.35 BioGRID, IntAct