Top
PIP4P2
Gene Name PIP4P2 (QuickGO )Interactive visualization of PIP4P2 structures
(A quick tutorial to explore the interactive visualization)
Synonyms
PIP4P2 , TMEM55A
Protein Name
PIP4P2
Alternative Name(s)
Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase;Type 2 PtdIns-4,5-P2 4-Ptase;3.1.3.78;PtdIns-4,5-P2 4-Ptase II;Transmembrane protein 55A;
EntrezGene ID 55529    (Comparative Toxicogenomics)
UniProt AC (Human)
Q8N4L2
(protein sequence )
Enzyme Class EC 3.1.3.78 (BRENDA ) Molecular Weight 28081 Dalton Protein Length 257 amino acids (AA) Genome Browsers NCBI | ENSG00000155099 (Ensembl) | UCSC Crosslinking annotations Query our ID-mapping tableOrthologues Quest For Orthologues (QFO) | GeneTree Classification Superfamily: Class I Cys-based PTPs --> Family: DSP | Historic class: Inositol 4,5-bisphosphate 4-phosphatase | CATH ID: NA | SCOP Fold: TMEM55 Phosphatase activity active | Catalytic signature motif: ICKDTSRR
Localization (UniProt annotation) Late endosome membrane Lysosome membrane Function (UniProt annotation) Catalyzes the hydrolysis of the 4-position phosphate ofphosphatidylinositol 4,5-bisphosphate Does not hydrolyzephosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol3,4-bisphosphate, inositol 3,5-bisphosphate, inositol 3,4-bisphosphate, phosphatidylinositol 5-monophosphate,phosphatidylinositol 4-monophosphate and phosphatidylinositol 3-monophosphate Catalytic Activity (UniProt annotation) 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate+ phosphate Protein Sequence MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAIASPDASGIPVINCRVCQSLINLDGKLHQHVVKCTV
CNEATPIKNPPTGKKYVRCPCNCLLICKDTSRRIGCPRPNCRRIINLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNT
FLWMELRFNTLAKCPHCKKISSVGSALPRRRCCAYITIGMICIFIGVGLTVGTPDFARRFRATYVSWAIAYLLGLICLIR
ACYWGAIRVSYPEHSFA
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CDK5RAP3 Affinity Capture-MS physical 20164180 , 28514442 , (Europe PMC )NA BioGRID F9 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GDPD5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GTF2IRD1 Two-hybrid physical 26275350 , (Europe PMC )NA BioGRID NEDD4L Reconstituted Complex physical 19953087 , (Europe PMC )NA BioGRID SLC39A5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TBC1D9 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TTC30B Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , , (Europe PMC )0.51 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CDK5RAP3 Affinity Capture-MS physical 20164180 , 28514442 , (Europe PMC )NA BioGRID F9 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GDPD5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GTF2IRD1 Two-hybrid physical 26275350 , (Europe PMC )NA BioGRID NEDD4L Reconstituted Complex physical 19953087 , (Europe PMC )NA BioGRID SLC39A5 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TBC1D9 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID TTC30B Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , , (Europe PMC )0.51 BioGRID, IntAct