Top
PHOSPHO1
Localization (UniProt annotation) N/A Function (UniProt annotation) Phosphatase that has a high activity towardphosphoethanolamine (PEA) and phosphocholine (PCho) Involved inthe generation of inorganic phosphate for bone mineralization Catalytic Activity (UniProt annotation) O-phosphoethanolamine + H(2)O = ethanolamine +phosphate Phosphocholine + H(2)O = choline + phosphate Protein Sequence MSGCFPVSGLRCLSRDGRMAAQGAPRFLLTFDFDETIVDENSDDSIVRAAPGQRLPESLRATYREGFYNEYMQRVFKYLG
EQGVRPRDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVILISDANTFGVESSLRAAGHHSLFRRILSNPSGPDARGLLAL
RPFHTHSCARCPANMCKHKVLSDYLRERAHDGVHFERLFYVGDGANDFCPMGLLAGGDVAFPRRGYPMHRLIQEAQKAEP
SSFRASVVPWETAADVRLHLQQVLKSC
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (Reactome) R-HSA-1483191 Synthesis of PC. <i>De novo</i> (Kennedy pathway) synthesis of phosphatidylcholine (PC) involves phosphorylation of choline (Cho) to phosphocholine (PCho) followed by condensing with cytidine triphosphate (CTP) to form CDP-choline (CDP-Cho). Diacylglycerol (DAG) and CDP-ETA together then form PC. Alternatively, PC is formed when phosphatidylethanolamine (PE) is methylated by phosphatidylethanolamine N-methyltransferase (PEMT) (Henneberry et al. 2002; Wright & McMaster 2002) R-HSA-1483213 Synthesis of PE. <i>De novo</i> (Kennedy pathway) synthesis of phosphatidylethanolamine (PE) involves phosphorylation of ethanolamine (ETA) to phosphoethanolamine (PETA) followed by condensing with cytidine triphosphate (CTP) to form CDP-ethanolamine (CDP-ETA). Diacylglycerol (DAG) and CDP-ETA together then form PE. Alternatively, PE is formed when phosphatidylserine (PS) is decarboxylated by phosphatidylserine decarboxylase proenzyme (PISD) (Henneberry et al. 2002, Vance 1991, Vance 1990)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CCT2 pull down association 28330616 , (Europe PMC )0.35 IntAct CCT3 pull down association 28330616 , (Europe PMC )0.35 IntAct CCT4 pull down association 28330616 , (Europe PMC )0.35 IntAct CCT5 pull down association 28330616 , (Europe PMC )0.35 IntAct CCT6A pull down association 28330616 , (Europe PMC )0.35 IntAct CCT7 pull down association 28330616 , (Europe PMC )0.35 IntAct CKB pull down association 28330616 , (Europe PMC )0.35 IntAct CS pull down association 28330616 , (Europe PMC )0.35 IntAct DDX39A pull down association 28330616 , (Europe PMC )0.35 IntAct ECHS1 pull down association 28330616 , (Europe PMC )0.35 IntAct EIF5A pull down association 28330616 , (Europe PMC )0.35 IntAct FKBP4 pull down association 28330616 , (Europe PMC )0.35 IntAct GANAB pull down association 28330616 , (Europe PMC )0.35 IntAct GOT2 pull down association 28330616 , (Europe PMC )0.35 IntAct GPI pull down association 28330616 , (Europe PMC )0.35 IntAct HINT1 pull down association 28330616 , (Europe PMC )0.35 IntAct HMGB2 pull down association 28330616 , (Europe PMC )0.35 IntAct HSPA4 pull down association 28330616 , (Europe PMC )0.35 IntAct HSPD1 pull down association 28330616 , (Europe PMC )0.35 IntAct HSPE1 pull down association 28330616 , (Europe PMC )0.35 IntAct KHSRP pull down association 28330616 , (Europe PMC )0.35 IntAct LDHA pull down association 28330616 , (Europe PMC )0.35 IntAct MARCKS pull down association 28330616 , (Europe PMC )0.35 IntAct MDH2 pull down association 28330616 , (Europe PMC )0.35 IntAct NME2 pull down association 28330616 , (Europe PMC )0.35 IntAct OAT pull down association 28330616 , (Europe PMC )0.35 IntAct P4HB pull down association 28330616 , (Europe PMC )0.35 IntAct PA2G4 pull down association 28330616 , (Europe PMC )0.35 IntAct PARK7 pull down association 28330616 , (Europe PMC )0.35 IntAct PDCD5 pull down association 28330616 , (Europe PMC )0.35 IntAct PDIA3 pull down association 28330616 , (Europe PMC )0.35 IntAct PDIA6 pull down association 28330616 , (Europe PMC )0.35 IntAct PEBP1 pull down association 28330616 , (Europe PMC )0.35 IntAct PFN1 pull down association 28330616 , (Europe PMC )0.35 IntAct PGAM1 pull down association 28330616 , (Europe PMC )0.35 IntAct PGK1 pull down association 28330616 , (Europe PMC )0.35 IntAct PPIB pull down association 28330616 , (Europe PMC )0.35 IntAct PRDX6 pull down association 28330616 , (Europe PMC )0.35 IntAct PRKCSH pull down association 28330616 , (Europe PMC )0.35 IntAct PTGES3 pull down association 28330616 , (Europe PMC )0.35 IntAct RANBP1 pull down association 28330616 , (Europe PMC )0.35 IntAct RPN1 pull down association 28330616 , (Europe PMC )0.35 IntAct STMN1 pull down association 28330616 , (Europe PMC )0.35 IntAct TCP1 pull down association 28330616 , (Europe PMC )0.35 IntAct TKT pull down association 28330616 , (Europe PMC )0.35 IntAct TMEM97 pull down association 28330616 , (Europe PMC )0.35 IntAct TPI1 pull down association 28330616 , (Europe PMC )0.35 IntAct TRAP1 pull down association 28330616 , (Europe PMC )0.35 IntAct UBA1 pull down association 28330616 , (Europe PMC )0.35 IntAct UBE2N pull down association 28330616 , (Europe PMC )0.35 IntAct UCHL1 pull down association 28330616 , (Europe PMC )0.35 IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ACY1 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CCT2 pull down association 28330616 , (Europe PMC )0.35 IntAct CCT3 pull down association 28330616 , (Europe PMC )0.35 IntAct CCT4 pull down association 28330616 , (Europe PMC )0.35 IntAct CCT5 pull down association 28330616 , (Europe PMC )0.35 IntAct CCT6A pull down association 28330616 , (Europe PMC )0.35 IntAct CCT7 pull down association 28330616 , (Europe PMC )0.35 IntAct CHTF18 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID CKB pull down association 28330616 , (Europe PMC )0.35 IntAct CS pull down association 28330616 , (Europe PMC )0.35 IntAct DDX39A pull down association 28330616 , (Europe PMC )0.35 IntAct ECHS1 pull down association 28330616 , (Europe PMC )0.35 IntAct EIF5A pull down association 28330616 , (Europe PMC )0.35 IntAct FKBP4 pull down association 28330616 , (Europe PMC )0.35 IntAct GANAB pull down association 28330616 , (Europe PMC )0.35 IntAct GOT2 pull down association 28330616 , (Europe PMC )0.35 IntAct GPI pull down association 28330616 , (Europe PMC )0.35 IntAct HINT1 pull down association 28330616 , (Europe PMC )0.35 IntAct HLA-DMB Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HLA-DRB1 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HMGB2 pull down association 28330616 , (Europe PMC )0.35 IntAct HSPA4 pull down association 28330616 , (Europe PMC )0.35 IntAct HSPD1 pull down association 28330616 , (Europe PMC )0.35 IntAct HSPE1 pull down association 28330616 , (Europe PMC )0.35 IntAct KHSRP pull down association 28330616 , (Europe PMC )0.35 IntAct LDHA pull down association 28330616 , (Europe PMC )0.35 IntAct MARCKS pull down association 28330616 , (Europe PMC )0.35 IntAct MDH2 pull down association 28330616 , (Europe PMC )0.35 IntAct NME2 pull down association 28330616 , (Europe PMC )0.35 IntAct OAT pull down association 28330616 , (Europe PMC )0.35 IntAct P4HB pull down association 28330616 , (Europe PMC )0.35 IntAct PA2G4 pull down association 28330616 , (Europe PMC )0.35 IntAct PARK7 pull down association 28330616 , (Europe PMC )0.35 IntAct PDCD5 pull down association 28330616 , (Europe PMC )0.35 IntAct PDIA3 pull down association 28330616 , (Europe PMC )0.35 IntAct PDIA6 pull down association 28330616 , (Europe PMC )0.35 IntAct PEBP1 pull down association 28330616 , (Europe PMC )0.35 IntAct PFN1 pull down association 28330616 , (Europe PMC )0.35 IntAct PGAM1 pull down association 28330616 , (Europe PMC )0.35 IntAct PGK1 pull down association 28330616 , (Europe PMC )0.35 IntAct PPIB pull down association 28330616 , (Europe PMC )0.35 IntAct PRDX6 pull down association 28330616 , (Europe PMC )0.35 IntAct PRKCSH pull down association 28330616 , (Europe PMC )0.35 IntAct PTGES3 pull down association 28330616 , (Europe PMC )0.35 IntAct RANBP1 pull down association 28330616 , (Europe PMC )0.35 IntAct RPN1 pull down association 28330616 , (Europe PMC )0.35 IntAct STMN1 pull down association 28330616 , (Europe PMC )0.35 IntAct TCP1 pull down association 28330616 , (Europe PMC )0.35 IntAct TKT pull down association 28330616 , (Europe PMC )0.35 IntAct TMEM97 pull down association 28330616 , (Europe PMC )0.35 IntAct TPI1 pull down association 28330616 , (Europe PMC )0.35 IntAct TRAP1 pull down association 28330616 , (Europe PMC )0.35 IntAct UBA1 pull down association 28330616 , (Europe PMC )0.35 IntAct UBE2N pull down association 28330616 , (Europe PMC )0.35 IntAct UCHL1 pull down association 28330616 , (Europe PMC )0.35 IntAct