Top
INPP5K
Gene Name INPP5K (QuickGO )Interactive visualization of INPP5K structures
(A quick tutorial to explore the interactive visualization)
Synonyms
INPP5K , PPS, SKIP
Protein Name
INPP5K
Alternative Name(s)
Inositol polyphosphate 5-phosphatase K;3.1.3.56;Skeletal muscle and kidney-enriched inositol phosphatase;
EntrezGene ID 51763    (Comparative Toxicogenomics)
UniProt AC (Human)
Q9BT40
(protein sequence )
Enzyme Class EC 3.1.3.56 (BRENDA ) Molecular Weight 51090 Dalton Protein Length 448 amino acids (AA) Genome Browsers NCBI | ENSG00000132376 (Ensembl) | UCSC Crosslinking annotations Query our ID-mapping tableOrthologues Quest For Orthologues (QFO) | GeneTree Classification Superfamily: inositol-5-phosphatases (IP) | Historic class: Inositol-1,4,5-trisphosphate 5-phosphatase | CATH ID: 3.60.10.10 | SCOP Fold: DNase I Phosphatase activity active | Catalytic signature motif: unknown
Localization (UniProt annotation) Endoplasmic reticulum Note=Following stimulation with EGF,translocates to membrane ruffles Function (UniProt annotation) Inositol 5-phosphatase which acts on inositol 1,4,5-trisphosphate, inositol 1,3,4,5-tetrakisphosphate,phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol3,4,5-trisphosphate Has 6-fold higher affinity forphosphatidylinositol 4,5-bisphosphate than for inositol 1,4,5-trisphosphate (PubMed:10753883) Negatively regulates assembly ofthe actin cytoskeleton Controls insulin-dependent glucose uptakeamong inositol 3,4,5-trisphosphate phosphatases; therefore, is thespecific regulator for insulin signaling in skeletal muscle (Bysimilarity) Catalytic Activity (UniProt annotation) D-myo-inositol 1,4,5-trisphosphate + H(2)O =myo-inositol 1,4-bisphosphate + phosphate Protein Sequence MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFNDSWSSFLMDVL
SPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYGYYVSIINCHLPPHISNNYQR
LEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIKNRCYGGLWEKDQLSIAKKHDPLLREFQEGR
LLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDL
ELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDI
SNIPTTEDEFLLCYYSNSLRSVVGISRPFQIPPGSLREDPLGEAQPQI
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (KEGG) hsa00562 Inositol phosphate metabolism hsa01100 Metabolic pathways hsa04070 Phosphatidylinositol signaling system hsa04910 Insulin signaling pathway Insulin binding to its receptor results in the tyrosine phosphorylation of insulin receptor substrates (IRS) by the insulin receptor tyrosine kinase (INSR). This allows association of IRSs with the regulatory subunit of phosphoinositide 3-kinase (PI3K). PI3K activates 3-phosphoinositide-dependent protein kinase 1 (PDK1), which activates Akt, a serine kinase. Akt in turn deactivates glycogen synthase kinase 3 (GSK-3), leading to activation of glycogen synthase (GYS) and thus glycogen synthesis. Activation of Akt also results in the translocation of GLUT4 vesicles from their intracellular pool to the plasma membrane, where they allow uptake of glucose into the cell. Akt also leads to mTOR-mediated activation of protein synthesis by eIF4 and p70S6K. The translocation of GLUT4 protein is also elicited through the CAP/Cbl/TC10 pathway, once Cbl is phosphorylated by INSR.Other signal transduction proteins interact with IRS including GRB2. GRB2 is part of the cascade including SOS, RAS, RAF and MEK that leads to activation of mitogen-activated protein kinase (MAPK) and mitogenic responses in the form of gene transcription. SHC is another substrate of INSR. When tyrosine phosphorylated, SHC associates with GRB2 and can thus activate the RAS/MAPK pathway independently of IRS-1.
Pathway ID Pathway Name Pathway Description (Reactome) R-HSA-1660499 Synthesis of PIPs at the plasma membrane. At the plasma membrane, subsequent phosphorylation of phosphatidylinositol 4-phosphate (PI4P) produces phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2) and phosphatidylinositol 3,4,5-trisphosphate (PI(3,4,5)P3) while the actions of various other kinases and phosphatases produces phosphatidylinositol 3-phosphate (PI3P), phosphatidylinositol 5-phosphate (PI5P), phosphatidylinositol 3,4-bisphosphate (PI(3,4)P2), and phosphatidylinositol 3,5-bisphosphate (PI(3,5)P2) (Zhang et al. 1997, Gurung et al. 2003, Guo et al. 1999, Vanhaesebroeck et al. 1997, Tolias et al. 1998, Schaletzky et al. 2003, Kim et al. 2002, Clarke et al. 2010). Many of the phosphatidylinositol phosphatases that act at the plasma membrane belong to the myotubularin family. Enzymatically inactive myotubularin family members can heterodimerize with catalytically active mytotubularins to regulate their stability, activity and/or substrate specificity (Berger et al. 2006, Zou et al. 2012)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AAMP Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ABHD10 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ANXA7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ARL6IP1 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach physical, physical association 16189514 , , (Europe PMC )0.62 BioGRID, IntAct BDNF Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct C1orf131 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CDKN1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CPTP Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct FATE1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , , (Europe PMC )0.70 BioGRID, IntAct GART Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GPHA2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HMOX2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HSPB1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KATNA1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID KRT31 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , , (Europe PMC )0.70 BioGRID, IntAct MAD2L1BP Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 28514442 , , (Europe PMC )0.70 BioGRID, IntAct MOV10 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID NCOR2 Two-hybrid physical 11509665 , (Europe PMC )NA BioGRID NECTIN3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID NXF1 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID PES1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PFDN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PROSER2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RFX1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RIPK3 Affinity Capture-MS physical 21903422 , (Europe PMC )NA BioGRID SMN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TANK Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct TK1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TTR Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID USP47 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID WDYHV1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ANXA7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ARL6IP1 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach physical, physical association 16189514 , , (Europe PMC )0.62 BioGRID, IntAct BCAR1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct BDNF Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct CDKN1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CPTP Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct DCD anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EPPK1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct FATE1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , , (Europe PMC )0.70 BioGRID, IntAct HMOX2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HSCB anti bait coimmunoprecipitation association 28380382 , (Europe PMC )0.35 IntAct HSPB1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KRT31 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , , (Europe PMC )0.70 BioGRID, IntAct LNX1 anti tag coimmunoprecipitation, fluorescence microscopy, two hybrid colocalization, physical association 16002321 , (Europe PMC )0.54 IntAct MAD2L1BP Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 28514442 , , (Europe PMC )0.70 BioGRID, IntAct PDXDC1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PFDN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PYGM anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct SMN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TANK Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct TK1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TTR Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source ANXA7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CDKN1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HMOX2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PFDN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT SMN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TK1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TTR Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source AAMP Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID ABHD10 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID ANXA7 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT ARL6IP1 Two-hybrid, two hybrid array, two hybrid pooling approach, two hybrid prey pooling approach physical, physical association 16189514 , , (Europe PMC )0.62 BioGRID, IntAct BCAR1 anti bait coimmunoprecipitation association 28007913 , (Europe PMC )0.35 IntAct BDNF Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct C1orf131 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID CDKN1A Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT CPTP Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct DCD anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct EPPK1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct FATE1 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , , (Europe PMC )0.70 BioGRID, IntAct GART Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID GPHA2 Affinity Capture-MS physical 26186194 , (Europe PMC )NA BioGRID HMOX2 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT HSCB anti bait coimmunoprecipitation association 28380382 , (Europe PMC )0.35 IntAct HSPB1 Two-hybrid, reverse ras recruitment system physical, physical association 25277244 , (Europe PMC )0.37 BioGRID, IntAct KATNA1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID KRT31 Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , , (Europe PMC )0.70 BioGRID, IntAct LNX1 anti tag coimmunoprecipitation, fluorescence microscopy, two hybrid colocalization, physical association 16002321 , (Europe PMC )0.54 IntAct MAD2L1BP Affinity Capture-MS, Two-hybrid, two hybrid array, two hybrid prey pooling approach, validated two hybrid physical, physical association 25416956 , 28514442 , , (Europe PMC )0.70 BioGRID, IntAct MOV10 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID NCOR2 Two-hybrid physical 11509665 , (Europe PMC )NA BioGRID NECTIN3 Affinity Capture-MS physical 26186194 , 28514442 , (Europe PMC )NA BioGRID NXF1 Affinity Capture-RNA physical 22658674 , (Europe PMC )NA BioGRID PDXDC1 anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct PES1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PFDN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT PROSER2 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID PYGM anti bait coimmunoprecipitation physical association 17353931 , (Europe PMC )0.40 IntAct RFX1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID RIPK3 Affinity Capture-MS physical 21903422 , (Europe PMC )NA BioGRID SMN1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TANK Two-hybrid, two hybrid array physical, physical association 21988832 , (Europe PMC )0.37 BioGRID, IntAct TK1 Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT TTR Two-hybrid, two hybrid physical, physical association 21900206 , (Europe PMC )0.37 BioGRID, IntAct, MINT UBB Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID USP47 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID WDYHV1 Affinity Capture-MS physical 28514442 , (Europe PMC )NA BioGRID