Top
INPP5E
Gene Name INPP5E (QuickGO )Interactive visualization of INPP5E structures
(A quick tutorial to explore the interactive visualization)
Synonyms
INPP5E
Protein Name
INPP5E
Alternative Name(s)
72 kDa inositol polyphosphate 5-phosphatase;3.1.3.36;Phosphatidylinositol 4,5-bisphosphate 5-phosphatase;Phosphatidylinositol polyphosphate 5-phosphatase type IV;
EntrezGene ID 56623    (Comparative Toxicogenomics)
UniProt AC (Human)
Q9NRR6
(protein sequence )
Enzyme Class EC 3.1.3.36 (BRENDA ) Molecular Weight 70205 Dalton Protein Length 644 amino acids (AA) Genome Browsers NCBI | ENSG00000148384 (Ensembl) | UCSC Crosslinking annotations Query our ID-mapping tableOrthologues Quest For Orthologues (QFO) | GeneTree Classification Superfamily: inositol-5-phosphatases (IP) | Historic class: Inositol-1,4,5-trisphosphate 5-phosphatase | CATH ID: 3.60.10.10 | SCOP Fold: DNase I Phosphatase activity active | Catalytic signature motif: unknown Phosphorylation Network Visualize
Localization (UniProt annotation) Cytoplasm, cytoskeleton, cilium axoneme Golgi apparatus, Golgi stackmembrane Cell membrane Cell projection, ruffle Cytoplasm Note=Peripheral membrane proteinassociated with Golgi stacks Function (UniProt annotation) Converts phosphatidylinositol 3,4,5-trisphosphate(PtdIns 3,4,5-P3) to PtdIns-P2, and phosphatidylinositol 4,5-bisphosphate to phosphatidylinositol 4-phosphate Specific forlipid substrates, inactive towards water soluble inositolphosphates Catalytic Activity (UniProt annotation) 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 4-phosphate+ phosphate Protein Sequence MPSKAENLRPSEPAPQPPEGRTLQGQLPGAPPAQRAGSPPDAPGSESPALACSTPATPSGEDPPARAAPIAPRPPARPRL
ERALSLDDKGWRRRRFRGSQEDLEARNGTSPSRGSVQSEGPGAPAHSCSPPCLSTSLQEIPKSRGVLSSERGSPSSGGNP
LSGVASSSPNLPHRDAAVAGSSPRLPSLLPPRPPPALSLDIASDSLRTANKVDSDLADYKLRAQPLLVRAHSSLGPGRPR
SPLACDDCSLRSAKSSFSLLAPIRSKDVRSRSYLEGSLLASGALLGADELARYFPDRNVALFVATWNMQGQKELPPSLDE
FLLPAEADYAQDLYVIGVQEGCSDRREWETRLQETLGPHYVLLSSAAHGVLYMSLFIRRDLIWFCSEVECSTVTTRIVSQ
IKTKGALGISFTFFGTSFLFITSHFTSGDGKVAERLLDYTRTVQALVLPRNVPDTNPYRSSAADVTTRFDEVFWFGDFNF
RLSGGRTVVDALLCQGLVVDVPALLQHDQLIREMRKGSIFKGFQEPDIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVLY
RSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRDNIPLAAGKFDRELYLLGIKRRISKEIQRQQALQSQNSSTI
CSVS
ELM Motif Motif Instance Description Motif Regex NA NA NA NA
Pathway ID Pathway Name Pathway Description (Reactome) R-HSA-1660514 Synthesis of PIPs at the Golgi membrane. At the Golgi membrane, phosphatidylinositol 4-phosphate (PI4P) is primarily generated from phosphorylation of phosphatidylinositol (PI). Other phosphoinositides are also generated by the action of various kinases and phosphatases such as: phosphatidylinositol 3-phosphate (PI3P), phosphatidylinositol 3,4-bisphosphate (PI(3,4)P2), phosphatidylinositol 3,5-bisphosphate (PI(3,5)P2) (Godi et al. 1999, Minogue et al. 2001, Rohde et al. 2003, Sbrissa et al. 2007, Sbrissa et al. 2008, Domin et al. 2000, Arcaro et al. 2000) R-HSA-5624958 ARL13B-mediated ciliary trafficking of INPP5E. ARL13B is a ciliary-localized small GTPase with an atypical C-terminus containing a coiled coil domain and a proline rich domain (PRD) (Hori et al, 2008). Mutations in ARL13B are associated with the development of the ciliopathy Joubert's Syndrome (Cantagrel et al, 2008; Parisi et al, 2009). Studies in C. elegans and vertebrates suggest that ARL13B may play a role in stabilizing the interaction between the IFT A and B complexes and the kinesin-2 motors during anterograde traffic in the cilium (Cevik et al, 2010; Li et al, 2010; Cevik et al, 2013; reviewed in Li et al, 2012; Zhang et al, 2013). Recent work has shown an additional role for ARL13B in trafficking the inositol polyphosphate-5-phosphatase E (INPP5E) to the cilium through a network that also involves the phosphodiesterase PDE6D and the centriolar protein CEP164 (Humbert et al, 2012; Thomas et al, 2014; reviewed in Zhang et al, 2013). Mutations in INPP5E are also associated with the development of Joubert syndrome and other ciliopathies (Bielas et al, 2009; Jacoby et al, 2009; reviewed in Conduit et al, 2012)
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CBY1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct CDC25C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct CEP170 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct CWC25 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DCAF7 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DENND1A Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID DENND4A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DENND4C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct GIGYF2 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID HDAC4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct HDAC7 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KIF1C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LPIN3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MAP3K21 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID MAPKAP1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MTFR1L Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct NADK Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct NAV1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct NF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct OSBPL6 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PDE6D Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , , (Europe PMC )0.51 BioGRID, IntAct PHLDB2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PLEKHA7 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PTPN13 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PTPN14 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct RAB11FIP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct RALGPS2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct RASAL2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct RPGR Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , , (Europe PMC )0.27, 0.35 BioGRID, IntAct RPTOR Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct RTKN Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SH3RF3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct STARD13 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct TANC2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct TIAM1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct YWHAE Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , , (Europe PMC )0.51 BioGRID, IntAct ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CDC25C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct CEP170 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct CWC25 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DCAF7 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DENND4A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DENND4C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct HDAC4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct HDAC7 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KIF1C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LPIN3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MAPKAP1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MTFR1L Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct NADK Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct NAV1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct NF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct OSBPL6 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PDE6D Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , , (Europe PMC )0.51 BioGRID, IntAct PHLDB2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PLEKHA7 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PTPN13 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PTPN14 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct RAB11FIP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct RALGPS2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct RASAL2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct RPGR Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , , (Europe PMC )0.27, 0.35 BioGRID, IntAct RPTOR Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SH3RF3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct STARD13 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct TANC2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct TIAM1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct YWHAE Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , , (Europe PMC )0.51 BioGRID, IntAct ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct
Visualize    Download
Interacting partner Detection method Interaction type PubMed IDs Interaction Score Source CBY1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct CDC25C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct CEP170 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct CGN Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct CWC25 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DCAF7 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DCLK1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DENND1A Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID DENND4A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct DENND4C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct EIF4E2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct GIGYF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct GIGYF2 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID HDAC4 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct HDAC7 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KCTD3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KIF13B Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KIF1C Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct KSR1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LIMA1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LPIN3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct LRFN1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MAGI1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MAP3K21 Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID MAPKAP1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MAST3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct MTFR1L Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct NADK Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct NAV1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct NF1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct OSBPL6 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PDE6D Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , , (Europe PMC )0.51 BioGRID, IntAct PHLDB2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PLEKHA7 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PPM1H Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PTPN13 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct PTPN14 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct RAB11FIP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct RALGPS2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct RASAL2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct RPGR Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , , (Europe PMC )0.27, 0.35 BioGRID, IntAct RPTOR Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct RTKN Affinity Capture-MS physical 27173435 , (Europe PMC )NA BioGRID SH3PXD2A Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SH3RF3 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SIPA1L1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct SRGAP2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct STARD13 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct TANC2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct TESK2 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct TIAM1 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct YWHAE Affinity Capture-MS, inference by socio-affinity scoring, tandem affinity purification association, physical, physical association 27173435 , , (Europe PMC )0.51 BioGRID, IntAct ZBTB21 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct ZNF638 Affinity Capture-MS, inference by socio-affinity scoring physical, physical association 27173435 , , (Europe PMC )0.27 BioGRID, IntAct