Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
Top
HDHD3
Gene Name  | HDHD3 (QuickGO) | (A quick tutorial to explore the interactive visualization) |
| Synonyms | HDHD3, C9orf158 | |
| Protein Name | HDHD3 |
|
|
Alternative Name(s) |
Haloacid dehalogenase-like hydrolase domain-containing protein 3; | |
| EntrezGene ID | 81932 (Comparative Toxicogenomics) | |
| UniProt AC (Human) | Q9BSH5 (protein sequence) | |
| Enzyme Class | N/A | |
| Molecular Weight | 28000 Dalton | |
| Protein Length | 251 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000119431 (Ensembl) | | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: HAD | Historic class: HAD-like hydrolase | CATH ID: 3.40.50.1000 | SCOP Fold: HAD | |
| Phosphatase activity | active | Catalytic signature motif: unknown | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| N/A | |||
| Function (UniProt annotation) | |||
| NA | |||
| Catalytic Activity (UniProt annotation) | |||
| NA | |||
| Protein Sequence | |||
| MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVL QTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTS EAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPA LDCLEGSTPGL |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0008152 | P:metabolic process |
| GO:0016787 | F:hydrolase activity |