Statistics
241 human active and 13 inactive phosphatases in total;
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
194 phosphatases have substrate data;
--------------------------------
336 protein substrates;
83 non-protein substrates;
1215 dephosphorylation interactions;
--------------------------------
299 KEGG pathways;
876 Reactome pathways;
--------------------------------
last scientific update:
11 Mar, 2019
Top
DUSP13
Gene Name  | DUSP13 (QuickGO) | (A quick tutorial to explore the interactive visualization) |
| Synonyms | DUSP13, BEDP, DUSP13A, MDSP | |
| Protein Name | DUSP13 |
|
|
Alternative Name(s) |
Dual specificity protein phosphatase 13 isoform A;DUSP13A;3.1.3.16;3.1.3.48;Branching-enzyme interacting DSP;Muscle-restricted DSP;MDSP; | |
| EntrezGene ID | 51207 (Comparative Toxicogenomics) | |
| UniProt AC (Human) | Q6B8I1 (protein sequence) | |
| Enzyme Class | EC 3.1.3.16 3.1.3.48 (BRENDA ) | |
| Molecular Weight | 20658 Dalton | |
| Protein Length | 188 amino acids (AA) | |
| Genome Browsers | NCBI | ENSG00000079393 (Ensembl) | UCSC | |
| Crosslinking annotations | Query our ID-mapping table | |
| Orthologues | Quest For Orthologues (QFO) | GeneTree | |
| Classification | Superfamily: Class I Cys-based PTPs --> Family: DSP | Historic class: Class I Cys-based PTPs --> VH1-like or DSPs --> Atypical DSPs | CATH ID: 3.90.190.10 | SCOP Fold: CC1 | |
| Phosphatase activity | active | Catalytic signature motif: HCSAGVGR | |
| Domain organization, Expression, Diseases | (show / hide) |
| Protein Domain | InterPro | Pfam | SMART | 3D Structure | PDB | DrugPort | ModBase | SwissModel |
| Polypeptide organization (Pfam) | No Pfam domain found | ||
| Catalytic Site | Mechanism and Catalytic Site Atlas | ||
| Gene Expression | Gene Expression Atlas | Diseases | OMIM | DisGeNet | ClinVar |
| Protein-protein interactions | STRING | IntAct | MINT | BioGRID | ||
| Phosphosites | Phospho.ELM | PhosphoSitePlus | ||
| Localization, Function, Catalytic activity and Sequence | (show / hide) |
| Localization (UniProt annotation) | |||
| Cytoplasm | |||
| Function (UniProt annotation) | |||
| Probable protein tyrosine phosphatase Has phosphataseactivity with synthetic substrates (PubMed:15252030,PubMed:29106959) Has a phosphatase activity-independentregulatory role in MAP3K5/ASK1-mediated apoptosis, preventingMAP3K5/ASK1 inhibition by AKT1 Shows no phosphatase activity onMAPK1/ERK2, MAPK8/JNK, MAPK14/p38 and MAP3K5/ASK1 | |||
| Catalytic Activity (UniProt annotation) | |||
| Protein tyrosine phosphate + H(2)O = proteintyrosine + phosphate [a protein]-serine/threonine phosphate + H(2)O= [a protein]-serine/threonine + phosphate | |||
| Protein Sequence | |||
| MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNAAHKGLYCQGG PDFYGSSVSYLGVPAHDLPDFDISAYFSSAADFIHRALNTPGAKVLVHCVVGVSRSATLVLAYLMLHQRLSLRQAVITVR QHRWVFPNRGFLHQLCRLDQQLRGAGQS |
| Motif information from Eukaryotic Linear Motif atlas (ELM) | (show / hide) |
ELM Motif | Motif Instance | Description | Motif Regex |
| NA | NA | NA | NA |
| Gene Ontology (P: Process; F: Function and C: Component terms) | (show / hide) | |
| GO:0004725 | F:protein tyrosine phosphatase activity |
| GO:0005737 | C:cytoplasm |
| GO:0008138 | F:protein tyrosine/serine/threonine phosphatase activity |
| GO:0016311 | P:dephosphorylation |
| GO:0016791 | F:phosphatase activity |
